CATH Domain: 3bnyD00 XML data for domain: 3bnyD00

Molscript image for 3bnyD00
3bnyD00
PDB coordinates for domain 3bnyD00

PDB 3bny, Chain D, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.600 Farnesyl Diphosphate Synthase
1.10.600.10 Farnesyl Diphosphate Synthase Gene3D
1.10.600.10.4
1.10.600.10.4.1
1.10.600.10.4.1.1
1.10.600.10.4.1.1.1
1.10.600.10.4.1.1.1.1

[top]
Segment boundaries for domain 3bnyD00

Chopping figure for domain 3bnyD00
DomainStart PDB ResidueStop PDB Residue
3bnyD00 13 317

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.10.600.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ps1A00 78.29 Streptomyces sp. UC5319Pentalenene synthase 1.10.600.10 304 11 91 3.91 4.26
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3bnyD00
SLEPPPSTFQPLCHPLVEEVSKEVDGYFLQHWNFPNEKARKKFVAAGFSRVTCLYFPKALDDRIHFACRLLTVLFLIDDL
LEYMSFEEGSAYNEKLIPISRGDVLPDRSIPVEYIIYDLWESMRAHDREMADEILEPVFLFMRAQTDRTRARPMGLGGYL
EYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHLSVVNDIYSYEKELYTSKLCTSVQILAQEADVTAEAAK
RVLFVMCREWELRHQLLVARLSAEGLETPGLAAYVEGLEYQMSGNELWSQTTLRYSV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3bnyD00
MKKPNGTNGASSSLEPPPSTFQPLCHPLVEEVSKEVDGYFLQHWNFPNEKARKKFVAAGFSRVTCLYFPKALDDRIHFAC
RLLTVLFLIDDLLEYMSFEEGSAYNEKLIPISRGDVLPDRSIPVEYIIYDLWESMRAHDREMADEILEPVFLFMRAQTDR
TRARPMGLGGYLEYRERDVGKELLAALMRFSMGLKLSPSELQRVREIDANCSKHLSVVNDIYSYEKELYTSKTAHSEGGI
LCTSVQILAQEADVTAEAAKRVLFVMCREWELRHQLLVARLSAEGLETPGLAAYVEGLEYQMSGNELWSQTTLRYSVVVD
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 30 Mar 2008 03:13

Assigning to "1.10.600.10" based on similarity with "2e4oA00"

Flow stage update by auto on 30 Mar 2008 03:13

No in_process hits for Domain "3bnyD00" ready to be processed

Update comment by auto on 29 Mar 2008 23:15

Domain "3bnyD00" hits Domain "3bnyA00" (100% over 100%) which is currently in process

Flow stage update by auto on 29 Mar 2008 23:04

Domain "3bnyD00" hits Domain "3bnyA00" (100% over 100%) which is currently in process

Flow stage update by auto on 29 Mar 2008 23:04

NW result present for Domain "3bnyD00"

Flow stage update by auto on 29 Mar 2008 11:05

All required files are present for Domain "3bnyD00"

Flow stage update by auto on 28 Mar 2008 15:05

Beginning processing for Domain "3bnyD00"

Insertion by auto on 28 Mar 2008 14:06

Final ChopClose added based on similarity with "2e4oA"