CATH Domain: 3blzA00 XML data for domain: 3blzA00

Molscript image for 3blzA00
3blzA00
PDB coordinates for domain 3blzA00

PDB 3blz, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.450 Nuclear Transport Factor 2; Chain: A,
3.10.450.50 Gene3D
3.10.450.50.18
3.10.450.50.18.1
3.10.450.50.18.1.1
3.10.450.50.18.1.1.1
3.10.450.50.18.1.1.1.1

[top]
Segment boundaries for domain 3blzA00

Chopping figure for domain 3blzA00
DomainStart PDB ResidueStop PDB Residue
3blzA00 3 126

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 3.10.450.50.18.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 10 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2owpA00 84.35 Burkholderia xenovorans LB400Putative uncharacterized protein 3.10.450.50 124 7 95 3.24 3.40
2ux0B00 83.35 Calcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiensCalcium- and calmodulin-dependent protein kinase complex 3.10.450.50 136 10 86 3.14 3.62
3b7cA00 83.33 Shewanella oneidensisPutative uncharacterized protein 3.10.450.50 115 11 86 2.68 3.11
3bb9B00 83.15 Putative orphan proteinShewanella frigidimarina NCIMB 400 3.10.450.50 120 10 89 3.78 4.23
3cnxA00 82.27 Streptomyces avermitilisPutative uncharacterized protein 3.10.450.50 135 8 84 2.46 2.91
1of5B00 81.86 Nuclear poreNuclear RNA export factor complexMRNA transport regulator MTR2Ribosomal large subunit export from nucleusSaccharomyces cerevisiae 3.10.450.50 128 7 88 3.18 3.60
3cu3A00 80.37 Domain of unknown function with a cystatin-like foldNostoc punctiforme PCC 73102 3.10.450.50 160 9 71 2.88 4.04
1vqqB01 77.31 Staphylococcus aureusPenicillin binding protein 2' 3.10.450.100 103 8 78 3.66 4.69
1q42A00 76.34 MRNA transport regulator MTR2Candida albicans 3.10.450.50 159 4 70 3.15 4.47
1q40D00 74.55 MRNA export factor MEX67Candida albicans 3.10.450.50 169 4 65 3.06 4.70
[1]
Displaying entries 1 to 10 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3blzA00
NTTYVQEYHAIVEVLSKYNEGGKKADSTIRPAFSSQATIFGVDVDNKLTGGPIQGLFDVIDNVFHPSPEAKAAIARIDIV
GTAASARIDTDDISGFRFTDFFNLLKVEGKWTVVSKIYHTHPS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3blzA00
GXTNTTYVQEYHAIVEVLSKYNEGGKKADSTIXRPAFSSQATIFGVDVDNKLTGGPIQGLFDVIDNVFHPSPEAKAAIAR
IDIVGTAASARIDTDDISGFRFTDFFNLLKVEGKWTVVSKIYHTHPSA
BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 18 Feb 2009 20:09

Assigning to "3.10.450.50" based on similarity with "3blzL00"

Flow stage update by auto on 18 Feb 2009 19:41

No in_process hits for Domain "3blzA00" ready to be processed

Update comment by auto on 18 Feb 2009 19:15

Domain "3blzA00" hits Domain "3blzL00" (98.4375% over 100%) which is currently in process

Update comment by auto on 18 Feb 2009 18:48

Domain "3blzA00" hits Domain "3blzK00" (98.4375% over 100%) which is currently in process

Update comment by auto on 18 Feb 2009 18:16

Domain "3blzA00" hits Domain "3blzH00" (98.4375% over 100%) which is currently in process

Update comment by auto on 26 Nov 2008 11:09

Domain "3blzA00" hits Domain "3blzG00" (98.4375% over 100%) which is currently in process

Flow stage update by auto on 26 Nov 2008 11:07

Domain "3blzA00" hits Domain "3blzG00" (98.4375% over 100%) which is currently in process

Flow stage update by auto on 26 Nov 2008 11:07

NW result present for Domain "3blzA00"

Flow stage update by auto on 20 Nov 2008 11:08

All required files are present for Domain "3blzA00"

Flow stage update by auto on 19 Nov 2008 17:59

Beginning processing for Domain "3blzA00"

Insertion by cuff on 19 Nov 2008 16:44

nice chopping