CATH Domain: 3blnA00

There are 61 matching structural neighberhood comparisons for CATH ID 3.40.630.30.6.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	1s3zA00	84.83	Salmonella enterica subsp. enterica serovar EnteritidisAminoglycoside 6'-N-acetyltransferase	3.40.630.30	147	17	87	3.71	4.26
	2fiaA00	84.71	Acetyltransferase, GNAT familyEnterococcus faecalis	3.40.630.30	157	17	87	3.13	3.59
	1mk4A00	84.37	Bacillus subtilisUncharacterized protein yqjY	3.40.630.30	157	13	86	3.01	3.47
	3k9uA00	84.34	Putative uncharacterized protein Ta0374Thermoplasma acidophilum	3.40.630.30	159	13	81	2.35	2.87
	2ae6A00	84.16	Acetyltransferase, GNAT familyEnterococcus faecalis	3.40.630.30	144	13	90	3.58	3.97
	1q2yA00	83.60	Bacillus subtilisUncharacterized N-acetyltransferase yjcF	3.40.630.30	140	12	92	3.22	3.49
	1cjwA00	83.54	Ovis ariesSerotonin N-acetyltransferase	3.40.630.30	166	11	81	2.69	3.31
	3fncA00	83.51	Listeria innocuaLin0611 protein	3.40.630.30	157	14	85	2.76	3.21
	2r7hB00	83.50	Desulfovibrio desulfuricans subsp. desulfuricans str. G20Putative uncharacterized protein	3.40.630.30	157	15	87	2.33	2.67
	2ozgA01	83.43	Anabaena variabilis ATCC 29413GCN5-related N-acetyltransferase	3.40.630.30	117	14	80	2.01	2.49
	2ge3B00	83.34	Agrobacterium tumefaciens str. C58Probable acetyltransferase	3.40.630.30	159	12	84	2.48	2.92
	2i79D00	83.21	Acetyltransferase, GNAT familyStreptococcus pneumoniae	3.40.630.30	167	12	82	2.64	3.22
	3d3sA00	83.02	L-2,4-diaminobutyric acid acetyltransferaseGlycine, serine and threonine metabolismBordetella parapertussisL-2,4-diaminobutyric acid acetyltransferase [EC:2.3.1.178]Metabolic pathways	3.40.630.30	157	12	85	3.06	3.56
	1qsmD00	82.81	CytoplasmIdentical protein bindingSaccharomyces cerevisiaeHistone acetyltransferase activityHistone acetyltransferase HPA2	3.40.630.30	152	12	83	3.00	3.59
	1tiqB00	82.74	Bacillus subtilisProtease synthase and sporulation negative regulatory protein PAI 1	3.40.630.30	161	15	85	3.21	3.77
	2q7bA00	82.53	Acetyltransferase, GNAT familyStreptococcus agalactiae serogroup V	3.40.630.30	161	11	82	3.23	3.91
	3g8wA00	82.49	Staphylococcus epidermidis ATCC 12228Lactococcal prophage ps3 protein 05	3.40.630.30	158	15	85	2.91	3.41
	2pdoA01	82.47	Shigella flexneriAcetyltransferase ypeA	3.40.630.30	118	13	79	2.46	3.08
	3exnA00	82.38	Tyrosine metabolismLimonene and pinene degradation1- and 2-Methylnaphthalene degradationPhenylalanine metabolismBenzoate degradation via CoA ligation	3.40.630.30	151	10	87	2.98	3.41
	1y9kA01	81.90	Tyrosine metabolismLimonene and pinene degradationIAA acetyltransferaseBacillus cereus ATCC 145791- and 2-Methylnaphthalene degradation	3.40.630.30	110	17	76	3.79	4.97
	2i00C01	81.89	Acetyltransferase, GNAT familyEnterococcus faecalis	3.40.630.30	144	5	83	2.61	3.13
	3fb3A00	81.75	Amino sugar and nucleotide sugar metabolismGlucosamine-phosphate N-acetyltransferase [EC:2.3.1.4]N-acetyltransferase, putativeTrypanosoma brucei	3.40.630.30	141	12	87	3.45	3.95
	2r1iA01	81.75	Arthrobacter sp. FB24GCN5-related N-acetyltransferase	3.40.630.30	129	10	79	2.82	3.56
	2fiwA00	81.71	Putative acetyltransferase [EC:2.3.1.-]GCN5-related N-acetyltransferase:Aminotransferase, class-IIRhodopseudomonas palustris	3.40.630.30	156	10	82	2.82	3.41
	1bo4A00	81.38	Aminoglycoside-(3)-N-acetyltransferaseSerratia marcescens	3.40.630.30	136	8	82	3.28	4.00
	3efaA00	81.37	Tyrosine metabolismBenzoate degradation via CoA ligationLactobacillus plantarumAcetyltransferase (Putative)Limonene and pinene degradation	3.40.630.30	141	10	90	2.65	2.92
	1sqhA02	81.37	Drosophila melanogasterCG14615	3.40.630.30	128	8	76	2.43	3.16
	2qecA00	81.17	Corynebacterium glutamicumGCN5-related N-acetyltransferase	3.40.630.30	175	20	77	3.46	4.49
	1gheA00	81.09	Tyrosine metabolismLimonene and pinene degradationAcetyltransferase1- and 2-Methylnaphthalene degradationPhenylalanine metabolism	3.40.630.30	166	10	81	2.62	3.22
	1qstA00	81.06	HAT A1Tetrahymena thermophila	3.40.630.30	160	9	80	2.92	3.65
	3fbuA00	80.94	Bacillus anthracisAcetyltransferase, GNAT family	3.40.630.30	166	15	83	2.76	3.32
	2dxqA00	80.73	Agrobacterium tumefaciens str. C58Acetyltransferase	3.40.630.30	145	10	86	3.69	4.25
	2atrA00	80.57	Acetyltransferase, GNAT familyStreptococcus pneumoniae	3.40.630.30	127	18	87	3.67	4.22
	3eo4A00	80.54	Methanocaldococcus jannaschiiUncharacterized protein MJ1062	3.40.630.30	155	12	83	2.89	3.47
	1xebA00	80.32	Pseudomonas aeruginosaElaA proteinPutative uncharacterized protein	3.40.630.30	146	12	89	3.29	3.67
	1n71B00	80.16	Aac(6')-Ii proteinEnterococcus faecium	3.40.630.30	179	12	75	2.59	3.41
	1y9wA01	80.06	AcetyltransferaseBacillus cereus ATCC 14579	3.40.630.30	104	20	71	2.98	4.18
	2pr1A00	80.04	Uncharacterized N-acetyltransferase ylbPBacillus subtilis	3.40.630.30	152	11	83	3.84	4.60
	2fl4A02	80.03	Arginine and proline metabolismSpermine/spermidine acetyltransferase, putativeDiamine N-acetyltransferase [EC:2.3.1.57]Metabolic pathwaysEnterococcus faecalis	3.40.630.30	104	15	70	2.60	3.69
	1vhsB00	79.97	Bacillus subtilisPhosphinothricin acetyltransferase [EC:2.3.1.183]Phosphonate and phosphinate metabolismPutative phosphinothricin acetyltransferase ywnH	3.40.630.30	155	12	87	3.38	3.85
	3d8pB00	79.96	Staphylococcus aureus subsp. aureus Mu50Putative uncharacterized protein	3.40.630.30	157	13	84	4.18	4.93
	1y7rA00	79.94	Staphylococcus aureus subsp. aureus Mu50Putative uncharacterized protein	3.40.630.30	125	11	84	3.36	3.99
	3f5bA00	79.38	Aminoglycoside N(6')acetyltransferaseLegionella pneumophila subsp. pneumophila str. Philadelphia 1	3.40.630.30	163	7	83	3.67	4.40
	2ozhA01	79.17	Xanthomonas campestris pv. campestrisPutative uncharacterized protein	3.40.630.30	120	15	79	3.41	4.27
	1u6mA00	78.97	Acetyltransferase, GNAT familyEnterococcus faecalis	3.40.630.30	188	15	71	2.69	3.77
	1nslA00	78.87	Bacillus subtilisPutative ribosomal N-acetyltransferase ydaF	3.40.630.30	173	10	78	3.14	3.99
	1lrzA01	78.75	Peptidoglycan biosynthesisMetabolic pathwaysPeptidoglycan pentaglycine glycine transferase (the second and third glycine) [EC:2.3.2.-]Aminoacyltransferase femAStaphylococcus aureus	3.40.630.30	143	6	83	3.87	4.61
	1yreC00	78.67	Pseudomonas aeruginosaPutative uncharacterized protein	3.40.630.30	182	12	76	3.26	4.27
	2hqyA02	78.65	Hypothetical proteinBacteroides thetaiotaomicronPutative uncharacterized protein	3.40.630.30	164	7	70	2.96	4.22
	2fckA00	78.53	Vibrio choleraeRibosomal-protein-serine acetyltransferase, putative	3.40.630.30	171	12	79	3.69	4.64
	1m4iB00	78.23	Aminoglycoside 2'-N-acetyltransferaseMycobacterium tuberculosis	3.40.630.30	176	9	72	2.96	4.07
	3gkrA02	78.07	Weissella viridescensFemX	3.40.630.30	165	7	69	2.82	4.05
	3dsbA01	77.84	Putative acetyltransferaseClostridium difficile 630	3.40.630.30	96	13	58	2.60	4.41
	2hv2A03	77.66	Enterococcus faecalisPutative uncharacterized protein	3.40.630.30	148	5	78	3.58	4.57
	2hv2A01	77.42	Enterococcus faecalisPutative uncharacterized protein	3.40.630.30	90	11	57	2.30	4.00
	2fsrA00	77.03	Agrobacterium tumefaciens str. C58Acetyltranferase	3.40.630.30	168	10	74	2.83	3.80
	1ro5A01	76.87	Pseudomonas aeruginosaAcyl homoserine lactone synthase [EC:2.3.1.184]Acyl-homoserine-lactone synthase	3.40.630.30	187	9	72	3.57	4.95
	3dnsA00	76.78	Ribosomal-protein-alanine N-acetyltransferase [EC:2.3.1.128]Clostridium acetobutylicumRibosomal-protein-alanine acetyltransferase (Acetylating enzyme for N-terminal of ribosomal protein S5)	3.40.630.30	126	15	78	3.75	4.78
	1rxtC01	76.49	Glycylpeptide N-tetradecanoyltransferase [EC:2.3.1.97]Protein lipoylationHomo sapiensGlycylpeptide N-tetradecanoyltransferase 1	3.40.630.30	132	6	76	3.62	4.75
	2q0yA01	75.67	Ralstonia eutropha JMP134GCN5-related N-acetyltransferase	3.40.630.30	125	10	75	3.27	4.33
	1kzfA00	72.72	Pantoea stewartii subsp. stewartiiAcyl-homoserine-lactone synthase	3.40.630.30	198	7	61	3.00	4.87

>pdb|3blnA00
GKNVTKASIDDLDSIVHIDIDVIGNDSRRNYIKHSIDEGRCVIVKEDNSISGFLTYDTNFFDCTFLSLIIVSPTKRRRGY
ASSLLSYLSHSPTQKIFSSTNESNESQKVFNANGFIRSGIVENLDEGDPEIIFYTKKLR    

>pdb|3blnA00
GXKNVTKASIDDLDSIVHIDIDVIGNDSRRNYIKHSIDEGRCVIVKEDNSISGFLTYDTNFFDCTFLSLIIVSPTKRRRG
YASSLLSYXLSHSPTQKIFSSTNESNESXQKVFNANGFIRSGIVENLDEGDPEIIFYTKKLRA