CATH Domain: 3bkbA01 XML data for domain: 3bkbA01

Molscript image for 3bkbA01
3bkbA01
PDB coordinates for domain 3bkbA01

PDB 3bkb, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.505 SHC Adaptor Protein
3.30.505.10 SHC Adaptor Protein Gene3D
3.30.505.10.12
3.30.505.10.12.1
3.30.505.10.12.1.1
3.30.505.10.12.1.1.1
3.30.505.10.12.1.1.1.1

[top]
Segment boundaries for domain 3bkbA01

Chopping figure for domain 3bkbA01
DomainStart PDB ResidueStop PDB Residue
3bkbA01 449 541
3bkbA02 553 642
3bkbA03 643 821

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 3.30.505.10.12.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 10 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1milA00 87.81 Transmembrane receptor protein tyrosine kinase adaptor activitySHC-transforming protein 1Regulation of epidermal growth factor receptor activityEpidermal growth factor receptor signaling pathwayInsulin-like growth factor receptor binding 3.30.505.10 104 32 86 1.90 2.20
2crhA01 87.35 Vav oncogeneChemokine signaling pathwayB cell receptor signaling pathwayLeukocyte transendothelial migrationFc gamma R-mediated phagocytosis 3.30.505.10 102 25 87 2.28 2.61
2kk6A00 87.19 CytoplasmFer (fps/fes related) tyrosine kinase [EC:2.7.10.2]Homo sapiensAdherens junctionTyrosine-protein kinase Fer 3.30.505.10 116 65 80 1.90 2.37
2iugA00 86.73 ErbB-3 class receptor bindingInsulin-like growth factor receptor signaling pathwayInsulin receptor signaling pathwayGrowth hormone receptor signaling pathwayInsulin-like growth factor receptor binding 3.30.505.10 110 27 82 2.47 2.99
2oq1A01 86.17 T cell receptor complexZeta-chain (TCR) associated protein kinase [EC:2.7.10.2]Natural killer cell mediated cytotoxicityPositive thymic T cell selectionTyrosine-protein kinase ZAP-70 3.30.505.10 108 25 82 3.12 3.79
1ayaA00 86.16 Hormone-mediated signaling pathwayRegulation of multicellular organism growthNerve growth factor receptor signaling pathwayTriglyceride metabolic processNegative regulation of insulin secretion 3.30.505.10 101 27 84 1.95 2.32
2dm0A01 85.09 Tyrosine-protein kinase TXKProtein phosphorylationTXK tyrosine kinase [EC:2.7.10.2]Leukocyte transendothelial migrationHomo sapiens 3.30.505.10 97 25 84 3.03 3.58
1i3zA00 84.96 Mus musculusSH2 domain-containing protein 1BNegative regulation of natural killer cell mediated cytotoxicityNegative regulation of peptidyl-tyrosine phosphorylationPhosphotyrosine binding 3.30.505.10 102 23 84 3.23 3.83
2vifA01 82.70 CytoplasmJAK-STAT cascadeDefense responseSuppressor of cytokine signaling 6Suppressor of cytokine signaling 6 3.30.505.10 126 32 73 3.66 4.96
2pldA00 81.02 Phosphatidylinositol signaling systemCalcium signaling pathwayPhospholipase C, gamma [EC:3.1.4.11]Pathways in cancerNeurotrophin signaling pathway 3.30.505.10 105 25 85 3.60 4.20
[1]
Displaying entries 1 to 10 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3bkbA01
PEVQKPLHEQLWYHGAIPRAEVAELLVHSGDFLVRESQGKQEYVLSVLWDGLPRHFIIQSLDNLYRLEGEGFPSIPLLID
HLLSTQQPLTKKS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3bkbA01
SMIPEVQKPLHEQLWYHGAIPRAEVAELLVHSGDFLVRESQGKQEYVLSVLWDGLPRHFIIQSLDNLYRLEGEGFPSIPL
LIDHLLSTQQPLTKKS
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 28 Apr 2009 08:46

Assigning to "3.30.505.10" based on similarity with "1wquA00"

Flow stage update by auto on 28 Apr 2009 08:15

No in_process hits for Domain "3bkbA01" ready to be processed

Flow stage update by auto on 28 Apr 2009 08:15

NW result present for Domain "3bkbA01"

Flow stage update by auto on 20 Apr 2009 08:14

All required files are present for Domain "3bkbA01"

Flow stage update by auto on 01 Apr 2009 09:36

Beginning processing for Domain "3bkbA01"

Insertion by cuff on 31 Mar 2009 17:28

nice chopping