Domain assigned by cuff on 09 Feb 2009 10:10
same superfamily
CATH Domain: 3bjsA01
3bjsA01
PDB 3bjs, Chain A, Domain 1
Segment boundaries for domain 3bjsA01
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 3bjsA01 | 37 | 156 |
| 3bjsA02 | 157 | 410 |
Structural Neighbourhood (4 entries)
There are 4 matching structural neighberhood comparisons for CATH ID 3.30.390.10.31.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 4 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
2qq6B01 | 87.66 | 3.30.390.10 | 115 | 20 | 81 | 2.02 | 2.47 | |
|
1jpdX01 | 83.63 | 3.30.390.10 | 99 | 19 | 81 | 2.67 | 3.26 | |
|
1yeyD01 | 78.78 | 3.30.390.10 | 172 | 16 | 65 | 2.96 | 4.51 | |
 |
1stzA03 | 76.04 | 3.30.390.60 | 89 | 14 | 73 | 3.27 | 4.46 |
[1]
Displaying entries 1 to 4 (page 1 of 1)
Domain ATOM Sequence
>pdb|3bjsA01 MKITKINAIPLSYRLPTVTMGVGSTIKRDAIIIRVETSEGITGYGEAHPGRSPGAITSLIHNTIAPMLIGMKATDCVGAW QRVHRMQLSSHGLGAGAALAISGIDMALWDIRGKAAN
Domain History Events (41)
Domain assignment manual match h by cuff on 09 Feb 2009 10:09
same superfamily
Homcheck allotment by cuff on 09 Feb 2009 10:08
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by cuff on 09 Feb 2009 10:08
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 29 Oct 2008 18:15
Domain "3bjsA01" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 29 Oct 2008 18:14
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3bjsA01
Flow stage update by auto on 29 Oct 2008 18:07
Retrieved PRC_PFAMCATH results for job ID SID8284931444164960 and results inserted.
Domain scan prc pfamcath by auto on 29 Oct 2008 18:07
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 37 results for 3bjsA01
Update comment by auto on 28 Oct 2008 19:10
PRC_PFAMCATH job SID8284931444164960 is not yet finished.
Prc pfamcath submit by auto on 28 Oct 2008 18:38
The entry "3bjsA01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 28 Oct 2008 18:38
The entry "3bjsA01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 28 Oct 2008 18:31
Retrieved SSAP results for job ID SID6597849036943472 and results inserted.
Domain scan ssap cath by auto on 28 Oct 2008 18:26
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 3468 results for 3bjsA01
Update comment by auto on 23 Oct 2008 21:24
SSAP job SID6597849036943472 is not yet finished.
Ssap cath submit by auto on 23 Oct 2008 20:57
The entry "3bjsA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 23 Oct 2008 20:57
The entry "3bjsA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 23 Oct 2008 20:50
Retrieved PRC results for job ID SID9897742034572368 and inserted them into the database.
Domain scan prc cath by auto on 23 Oct 2008 20:50
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 35 results for 3bjsA01
Update comment by auto on 23 Oct 2008 18:18
PRC job SID9897742034572368 is not yet finished.
Prc cath submit by auto on 23 Oct 2008 17:42
The entry "3bjsA01" has been submitted to the PRC webservice.
Flow stage update by auto on 23 Oct 2008 17:42
The entry "3bjsA01" has been submitted to the PRC webservice.
Flow stage update by auto on 23 Oct 2008 17:37
Retrieved HMM(SAM) results for job ID SID6960025935469088 and inserted them into the database.
Domain scan sam cath by auto on 23 Oct 2008 17:37
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 29 results for 3bjsA01
Update comment by auto on 23 Oct 2008 06:29
HMM(SAM) job SID6960025935469088 is not yet finished.
Flow stage update by auto on 23 Oct 2008 06:15
The entry "3bjsA01" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 23 Oct 2008 06:15
The entry "3bjsA01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 23 Oct 2008 06:04
Retrieved "3bjsA01" CATHEDRAL results for job ID SID2369116457122128 and inserted them into the database.
Domain scan cathedral cath by auto on 23 Oct 2008 06:04
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 34 results for 3bjsA01
Update comment by auto on 22 Oct 2008 14:45
"3bjsA01" CATHEDRAL job SID2369116457122128 is not yet finished.
Flow stage update by auto on 22 Oct 2008 14:39
The entry "3bjsA01" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 22 Oct 2008 14:39
The entry "3bjsA01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 22 Oct 2008 14:30
ScanList with 12259 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3bjsA01.scanlist" for "3bjsA01"
Write scan list by auto on 22 Oct 2008 14:30
Writing ScanList containing 12259 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3bjsA01.scanlist" for domain "3bjsA01"
Update comment by auto on 22 Oct 2008 11:51
Waiting for 14 new domains (example : 3dgvA01) to be processed so that they can be scanned against too.
Update comment by auto on 22 Oct 2008 09:11
Waiting for 42 new domains (example : 3cb5B01) to be processed so that they can be scanned against too.
Flow stage update by auto on 22 Oct 2008 09:11
No satisfactory AssignClose result found.
Flow stage update by auto on 22 Oct 2008 08:39
No in_process hits for Domain "3bjsA01" ready to be processed
Flow stage update by auto on 22 Oct 2008 08:39
NW result present for Domain "3bjsA01"
Flow stage update by auto on 21 Oct 2008 08:34
All required files are present for Domain "3bjsA01"
Flow stage update by auto on 20 Oct 2008 18:49
Beginning processing for Domain "3bjsA01"
Insertion by cuff on 20 Oct 2008 17:04
nice chopping
