Domain assigned by cuff on 09 Feb 2009 10:00
same superfamily
CATH Domain: 3bjnA00
3bjnA00
PDB 3bjn, Chain A, Domain 0
| CATH Code | Level Description | Links |
|---|---|---|
 3
| Alpha Beta | |
 3.30
| 2-Layer Sandwich | |
 3.30.450
| Beta-Lactamase | |
 3.30.450.40
| Gene3D | |
 3.30.450.40.5
| ||
 3.30.450.40.5.1
| ||
 3.30.450.40.5.1.1
| ||
 3.30.450.40.5.1.1.1
| ||
 3.30.450.40.5.1.1.1.1
|
Structural Neighbourhood (4 entries)
There are 4 matching structural neighberhood comparisons for CATH ID 3.30.450.40.5.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 4 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
|
2o0yB02 | 84.71 | 3.30.450.40 | 176 | 22 | 81 | 2.21 | 2.70 | |
|
2ia2A02 | 84.49 | 3.30.450.40 | 179 | 18 | 84 | 3.67 | 4.35 | |
|
1ysqA00 | 84.40 | 3.30.450.40 | 181 | 22 | 80 | 1.97 | 2.46 | |
|
3d3oA00 | 84.29 | 3.30.450.40 | 167 | 15 | 85 | 3.76 | 4.39 |
[1]
Displaying entries 1 to 4 (page 1 of 1)
Domain ATOM Sequence
>pdb|3bjnA00 SYETSQHNLDAVEAVLSRLQKQTGEAAYVPVGYRALCVSQRESQALRCSFVQGQSQPLLRGASSKVLAYPAARCEKILRY FGEDPTLDKWQSEFEKIRRHGYAVSTSEIDPGVSGISAPVKGSKLIGAISVAPAHRVESNKQRIILHVLQAARAL
Domain History Events (41)
Domain assignment manual match h by cuff on 09 Feb 2009 10:00
homology match
Homcheck allotment by cuff on 09 Feb 2009 09:58
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by cuff on 09 Feb 2009 09:58
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 29 Oct 2008 18:14
Domain "3bjnA00" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 29 Oct 2008 18:13
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3bjnA00
Flow stage update by auto on 29 Oct 2008 18:06
Retrieved PRC_PFAMCATH results for job ID SID1142560418722112 and results inserted.
Domain scan prc pfamcath by auto on 29 Oct 2008 18:06
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 5 results for 3bjnA00
Update comment by auto on 28 Oct 2008 20:50
PRC_PFAMCATH job SID1142560418722112 is not yet finished.
Flow stage update by auto on 28 Oct 2008 20:48
The entry "3bjnA00" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 28 Oct 2008 20:48
The entry "3bjnA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 28 Oct 2008 20:46
Retrieved SSAP results for job ID SID6835578054862928 and results inserted.
Domain scan ssap cath by auto on 28 Oct 2008 20:44
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 524 results for 3bjnA00
Update comment by auto on 23 Oct 2008 21:24
SSAP job SID6835578054862928 is not yet finished.
Flow stage update by auto on 23 Oct 2008 20:57
The entry "3bjnA00" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 23 Oct 2008 20:57
The entry "3bjnA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 23 Oct 2008 20:48
Retrieved PRC results for job ID SID7527188137104350 and inserted them into the database.
Domain scan prc cath by auto on 23 Oct 2008 20:48
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 6 results for 3bjnA00
Update comment by auto on 23 Oct 2008 18:18
PRC job SID7527188137104350 is not yet finished.
Flow stage update by auto on 23 Oct 2008 17:41
The entry "3bjnA00" has been submitted to the PRC webservice.
Prc cath submit by auto on 23 Oct 2008 17:41
The entry "3bjnA00" has been submitted to the PRC webservice.
Flow stage update by auto on 23 Oct 2008 17:36
Retrieved HMM(SAM) results for job ID SID7480591324359480 and inserted them into the database.
Domain scan sam cath by auto on 23 Oct 2008 17:35
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 6 results for 3bjnA00
Update comment by auto on 23 Oct 2008 06:29
HMM(SAM) job SID7480591324359480 is not yet finished.
Sam cath submit by auto on 23 Oct 2008 06:15
The entry "3bjnA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 23 Oct 2008 06:15
The entry "3bjnA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 23 Oct 2008 06:01
Retrieved "3bjnA00" CATHEDRAL results for job ID SID7275367330657280 and inserted them into the database.
Domain scan cathedral cath by auto on 23 Oct 2008 06:00
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 95 results for 3bjnA00
Update comment by auto on 22 Oct 2008 14:44
"3bjnA00" CATHEDRAL job SID7275367330657280 is not yet finished.
Flow stage update by auto on 22 Oct 2008 14:39
The entry "3bjnA00" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 22 Oct 2008 14:39
The entry "3bjnA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 22 Oct 2008 14:30
ScanList with 12259 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3bjnA00.scanlist" for "3bjnA00"
Write scan list by auto on 22 Oct 2008 14:30
Writing ScanList containing 12259 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3bjnA00.scanlist" for domain "3bjnA00"
Update comment by auto on 22 Oct 2008 11:51
Waiting for 14 new domains (example : 3dgvA01) to be processed so that they can be scanned against too.
Update comment by auto on 22 Oct 2008 09:11
Waiting for 42 new domains (example : 3cb5B01) to be processed so that they can be scanned against too.
Flow stage update by auto on 22 Oct 2008 09:11
No satisfactory AssignClose result found.
Flow stage update by auto on 22 Oct 2008 08:39
No in_process hits for Domain "3bjnA00" ready to be processed
Flow stage update by auto on 22 Oct 2008 08:39
NW result present for Domain "3bjnA00"
Flow stage update by auto on 21 Oct 2008 08:34
All required files are present for Domain "3bjnA00"
Flow stage update by auto on 20 Oct 2008 18:49
Beginning processing for Domain "3bjnA00"
Insertion by cuff on 20 Oct 2008 17:04
nice chopping
