Domain assigned by cuff on 10 Feb 2009 11:59
same superfamily
CATH Domain: 3bjeA01
3bjeA01
PDB 3bje, Chain A, Domain 1
| CATH Code | Level Description | Links |
|---|---|---|
 3
| Alpha Beta | |
 3.40
| 3-Layer(aba) Sandwich | |
 3.40.50
| Rossmann fold | |
 3.40.50.1580
| Gene3D | |
 3.40.50.1580.10
| ||
 3.40.50.1580.10.1
| ||
 3.40.50.1580.10.1.1
| ||
 3.40.50.1580.10.1.1.1
| ||
 3.40.50.1580.10.1.1.1.1
|
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|3bjeA01 KSDELADRIIFVGDPGRVDVISGYFDKDSIRASRDHREIRFATGTYKGTPVTVISTGMGVDNIEIVLNEIHALKEYDMER GQWRHRKGDADAPSAGPFFDPSTMKIIRLGTCGSPAESVPPLALAVTRHAIGMDNTSLYYSAGTRETSKDQQEIRRIVRE QTGLRAIDIYTSMAHPNITKSICAACDAHNAATGSEADKQQYVIGTTATASGFYGCQGRRVGRFMKHLTVPNMVEELGSL KFNLSNGVEVVTNIEMETSAICYLSDMLGYQAGAACVVVSKRVGEKKMFLGDQLDAAMKRCIKIILEALVSA
Domain COMBS Sequence
>pdb|3bjeA01 KSDELADRIIFVGDPGRVDVISGYFDKDSIRASRDHREIRFATGTYKGTPVTVISTGMGVDNIEIVLNEIHALKEYDMER GQWRHRKGDADAPSAGPFFDPSTMKIIRLGTCGSPAESVPPLALAVTRHAIGMDNTSLYYSAGTRETSKDQQEIRRIVRE QTGLRAIDIYTSMAHPNITKSICAACDAHNAATGSEADKQQYVIGTTATASGFYGCQGRRVGRFMKHLTVPNMVEELGSL KFNLSNGVEVVTNIEMETSAICYLSDMLGYQAGAACVVVSKRVGEKKMFLGDQLDAAMKRCIKIILEALVSA
Domain History Events (45)
Domain assignment manual match h by cuff on 06 Feb 2009 16:57
homology match
Homcheck allotment by cuff on 06 Feb 2009 16:54
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by cuff on 06 Feb 2009 16:54
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 01 Nov 2008 11:52
Domain "3bjeA01" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 01 Nov 2008 11:52
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3bjeA01
Flow stage update by auto on 01 Nov 2008 11:49
Retrieved PRC_PFAMCATH results for job ID SID9849433229375344 and results inserted.
Domain scan prc pfamcath by auto on 01 Nov 2008 11:49
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 71 results for 3bjeA01
Update comment by auto on 01 Nov 2008 09:24
PRC_PFAMCATH job SID9849433229375344 is not yet finished.
Prc pfamcath submit by auto on 01 Nov 2008 09:21
The entry "3bjeA01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 01 Nov 2008 09:21
The entry "3bjeA01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 01 Nov 2008 09:16
Retrieved SSAP results for job ID SID4610532925485460 and results inserted.
Domain scan ssap cath by auto on 01 Nov 2008 09:16
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 84 results for 3bjeA01
Update comment by auto on 29 Oct 2008 23:46
SSAP job SID4610532925485460 is not yet finished.
Flow stage update by auto on 29 Oct 2008 23:32
The entry "3bjeA01" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 29 Oct 2008 23:32
The entry "3bjeA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 29 Oct 2008 20:42
Giving up on SSAP job SID5911922042204337 because submission time of Thu Oct 23 20:57:19 2008 is more than 518400 seconds older than current time (Wed Oct 29 20:42:37 2008).
Update comment by auto on 23 Oct 2008 21:24
SSAP job SID5911922042204337 is not yet finished.
Ssap cath submit by auto on 23 Oct 2008 20:57
The entry "3bjeA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 23 Oct 2008 20:57
The entry "3bjeA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 23 Oct 2008 20:48
Retrieved PRC results for job ID SID8237921954841600 and inserted them into the database.
Domain scan prc cath by auto on 23 Oct 2008 20:47
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 11 results for 3bjeA01
Update comment by auto on 23 Oct 2008 18:18
PRC job SID8237921954841600 is not yet finished.
Flow stage update by auto on 23 Oct 2008 17:41
The entry "3bjeA01" has been submitted to the PRC webservice.
Prc cath submit by auto on 23 Oct 2008 17:41
The entry "3bjeA01" has been submitted to the PRC webservice.
Flow stage update by auto on 23 Oct 2008 17:35
Retrieved HMM(SAM) results for job ID SID1605556199148128 and inserted them into the database.
Domain scan sam cath by auto on 23 Oct 2008 17:34
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 8 results for 3bjeA01
Update comment by auto on 23 Oct 2008 06:29
HMM(SAM) job SID1605556199148128 is not yet finished.
Flow stage update by auto on 23 Oct 2008 06:14
The entry "3bjeA01" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 23 Oct 2008 06:14
The entry "3bjeA01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 23 Oct 2008 06:00
Retrieved "3bjeA01" CATHEDRAL results for job ID SID0795679292544760 and inserted them into the database.
Domain scan cathedral cath by auto on 23 Oct 2008 05:58
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 508 results for 3bjeA01
Update comment by auto on 22 Oct 2008 14:44
"3bjeA01" CATHEDRAL job SID0795679292544760 is not yet finished.
Cathedral cath submit by auto on 22 Oct 2008 14:39
The entry "3bjeA01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 22 Oct 2008 14:39
The entry "3bjeA01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 22 Oct 2008 14:30
ScanList with 12259 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3bjeA01.scanlist" for "3bjeA01"
Write scan list by auto on 22 Oct 2008 14:29
Writing ScanList containing 12259 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3bjeA01.scanlist" for domain "3bjeA01"
Update comment by auto on 22 Oct 2008 11:51
Waiting for 14 new domains (example : 3dgvA01) to be processed so that they can be scanned against too.
Update comment by auto on 22 Oct 2008 09:11
Waiting for 42 new domains (example : 3cb5B01) to be processed so that they can be scanned against too.
Flow stage update by auto on 22 Oct 2008 09:10
No satisfactory AssignClose result found.
Flow stage update by auto on 22 Oct 2008 08:39
No in_process hits for Domain "3bjeA01" ready to be processed
Flow stage update by auto on 22 Oct 2008 08:39
NW result present for Domain "3bjeA01"
Flow stage update by auto on 21 Oct 2008 08:34
All required files are present for Domain "3bjeA01"
Flow stage update by auto on 20 Oct 2008 18:49
Beginning processing for Domain "3bjeA01"
Insertion by cuff on 20 Oct 2008 17:04
nice chopping
