CATH Domain: 3bioA02 XML data for domain: 3bioA02

Molscript image for 3bioA02
3bioA02
PDB coordinates for domain 3bioA02

PDB 3bio, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.360 Dihydrodipicolinate Reductase; domain 2
3.30.360.10 Dihydrodipicolinate Reductase; domain 2 Gene3D
3.30.360.10.19
3.30.360.10.19.1
3.30.360.10.19.1.1
3.30.360.10.19.1.1.1
3.30.360.10.19.1.1.1.1

[top]
Segment boundaries for domain 3bioA02

Chopping figure for domain 3bioA02
DomainStart PDB ResidueStop PDB Residue
3bioA01 5 140
3bioA01 255 301
3bioA02 141 254

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|3bioA02
KGITYTNFGPGSGHTVAVKAIDGVKAALSTIPLGTGVHRRVYVELLPGHNLEEVSAAIKADEYFVHDETHVIQVDEVDAL
IDGHGVRVRKGVSGSTQNQRSFDEIN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3bioA02
KGITYTNFGPGXSXGHTVAVKAIDGVKAALSXTIPLGTGVHRRXVYVELLPGHNLEEVSAAIKADEYFVHDETHVIQVDE
VDALIDXGHGVRXVRKGVSGSTQNQRXSFDXEIN
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 25 Mar 2009 17:34

Assigning to "3.30.360.10" based on similarity with "3bioB02"

Flow stage update by auto on 25 Mar 2009 17:13

No in_process hits for Domain "3bioA02" ready to be processed

Update comment by auto on 30 Nov 2008 17:16

Domain "3bioA02" hits Domain "3bioB02" (92.9824561403509% over 100%) which is currently in process

Flow stage update by auto on 30 Nov 2008 17:13

Domain "3bioA02" hits Domain "3bioB02" (92.9824561403509% over 100%) which is currently in process

Flow stage update by auto on 30 Nov 2008 17:13

NW result present for Domain "3bioA02"

Flow stage update by auto on 28 Nov 2008 11:13

All required files are present for Domain "3bioA02"

Flow stage update by auto on 27 Nov 2008 20:08

Beginning processing for Domain "3bioA02"

Insertion by cuff on 27 Nov 2008 16:43

nice chopping