Domain assigned by cuff on 06 Feb 2009 15:44
same superfamily
CATH Domain: 3bhnA00
3bhnA00
PDB 3bhn, Chain A, Domain 0
| CATH Code | Level Description | Links |
|---|---|---|
 3
| Alpha Beta | |
 3.40
| 3-Layer(aba) Sandwich | |
 3.40.50
| Rossmann fold | |
 3.40.50.880
| Gene3D | |
 3.40.50.880.7
| ||
 3.40.50.880.7.1
| ||
 3.40.50.880.7.1.1
| ||
 3.40.50.880.7.1.1.1
| ||
 3.40.50.880.7.1.1.1.1
|
Structural Neighbourhood (2 entries)
There are 2 matching structural neighberhood comparisons for CATH ID 3.40.50.880.7.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 2 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
|
3cneA00 | 79.58 | 3.40.50.880 | 167 | 19 | 76 | 2.98 | 3.92 | |
|
2fexA00 | 78.77 | 3.40.50.880 | 172 | 16 | 81 | 3.20 | 3.92 |
[1]
Displaying entries 1 to 2 (page 1 of 1)
Domain ATOM Sequence
>pdb|3bhnA00 YKVGIVLFDDFTDVDFFLNDLLGRTSDSWTVRILGTKPEHHSQLGTVKTDGHVSEVKEQDVVLITSGYRGIPAALQDENF SALKLDPSRQLIGSICAGSFVLHELGLLKGKKLTTNPDAKAVLQGGGDVQDLPLVIEGNIATAGGCLSLLYLVGWLAERL FDSVKRKQIQNQLIPAGQEIFETLISETIQSAESAYEYRSACESDAES
Domain History Events (42)
Domain assignment manual match h by cuff on 06 Feb 2009 15:43
homology match
Homcheck allotment by cuff on 06 Feb 2009 15:40
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by cuff on 06 Feb 2009 15:40
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 29 Oct 2008 00:23
Domain "3bhnA00" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 29 Oct 2008 00:22
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3bhnA00
Flow stage update by auto on 29 Oct 2008 00:12
Retrieved PRC_PFAMCATH results for job ID SID0329075612734770 and results inserted.
Domain scan prc pfamcath by auto on 29 Oct 2008 00:11
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 61 results for 3bhnA00
Update comment by auto on 28 Oct 2008 07:41
PRC_PFAMCATH job SID0329075612734770 is not yet finished.
Prc pfamcath submit by auto on 28 Oct 2008 07:32
The entry "3bhnA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 28 Oct 2008 07:32
The entry "3bhnA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 28 Oct 2008 07:10
Retrieved SSAP results for job ID SID2184417680597560 and results inserted.
Domain scan ssap cath by auto on 28 Oct 2008 07:07
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1074 results for 3bhnA00
Update comment by auto on 23 Oct 2008 21:23
SSAP job SID2184417680597560 is not yet finished.
Ssap cath submit by auto on 23 Oct 2008 20:55
The entry "3bhnA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 23 Oct 2008 20:55
The entry "3bhnA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 23 Oct 2008 20:41
Retrieved PRC results for job ID SID4304199547798324 and inserted them into the database.
Domain scan prc cath by auto on 23 Oct 2008 20:41
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 21 results for 3bhnA00
Update comment by auto on 23 Oct 2008 14:56
PRC job SID4304199547798324 is not yet finished.
Prc cath submit by auto on 23 Oct 2008 14:49
The entry "3bhnA00" has been submitted to the PRC webservice.
Flow stage update by auto on 23 Oct 2008 14:49
The entry "3bhnA00" has been submitted to the PRC webservice.
Flow stage update by auto on 23 Oct 2008 14:40
Retrieved HMM(SAM) results for job ID SID3747081512317312 and inserted them into the database.
Domain scan sam cath by auto on 23 Oct 2008 14:40
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 6 results for 3bhnA00
Update comment by auto on 23 Oct 2008 06:28
HMM(SAM) job SID3747081512317312 is not yet finished.
Flow stage update by auto on 23 Oct 2008 06:13
The entry "3bhnA00" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 23 Oct 2008 06:13
The entry "3bhnA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 23 Oct 2008 05:43
Retrieved "3bhnA00" CATHEDRAL results for job ID SID1099614481852016 and inserted them into the database.
Domain scan cathedral cath by auto on 23 Oct 2008 05:41
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 489 results for 3bhnA00
Update comment by auto on 22 Oct 2008 14:44
"3bhnA00" CATHEDRAL job SID1099614481852016 is not yet finished.
Cathedral cath submit by auto on 22 Oct 2008 14:38
The entry "3bhnA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 22 Oct 2008 14:38
The entry "3bhnA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 22 Oct 2008 14:28
ScanList with 12259 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3bhnA00.scanlist" for "3bhnA00"
Write scan list by auto on 22 Oct 2008 14:27
Writing ScanList containing 12259 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3bhnA00.scanlist" for domain "3bhnA00"
Update comment by auto on 22 Oct 2008 11:51
Waiting for 14 new domains (example : 3dgvA01) to be processed so that they can be scanned against too.
Update comment by auto on 22 Oct 2008 09:11
Waiting for 42 new domains (example : 3cb5B01) to be processed so that they can be scanned against too.
Update comment by auto on 22 Oct 2008 06:03
Waiting for 73 new domains (example : 3bjeA01) to be processed so that they can be scanned against too.
Flow stage update by auto on 22 Oct 2008 06:02
No satisfactory AssignClose result found.
Flow stage update by auto on 22 Oct 2008 05:26
No in_process hits for Domain "3bhnA00" ready to be processed
Flow stage update by auto on 22 Oct 2008 05:26
NW result present for Domain "3bhnA00"
Flow stage update by auto on 21 Oct 2008 08:34
All required files are present for Domain "3bhnA00"
Flow stage update by auto on 20 Oct 2008 18:49
Beginning processing for Domain "3bhnA00"
Insertion by cuff on 20 Oct 2008 17:04
nice chopping
