Domain assigned by cuff on 06 Feb 2009 15:18
same superfamily
CATH Domain: 3bgaA05
3bgaA05
PDB 3bga, Chain A, Domain 5
Segment boundaries for domain 3bgaA05
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 3bgaA01 | 27 | 245 |
| 3bgaA02 | 246 | 356 |
| 3bgaA03 | 357 | 637 |
| 3bgaA04 | 638 | 742 |
| 3bgaA05 | 754 | 1023 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|3bgaA05 GETAFVVDKNTGALSSLTLDGKELLAAPITLSLFRPATDNDNRDRNGARLWRKAGLNNLTQKVVSLKEEKTSATVRAEIL NGKGQKVGADFVYALDKNGALKVRTTFQPDTAIVKSARLGLTFRADAYNQVSYLGRGDHETYIDRNQSGRIGLYDTTVER FHYYATPQSTANRTDVRWAKLTDQAGEGVFESNRPFQFSIIPFSDVLLEKAHHINELERDGITIHLDAEQAGVGTATCGP GVLPQYLVPVKKQSFEFTLYPVKE
Domain COMBS Sequence
>pdb|3bgaA05 GETAFVVDKNTGALSSLTLDGKELLAAPITLSLFRPATDNDNRDRNGARLWRKAGLNNLTQKVVSLKEEKTSATVRAEIL NGKGQKVGXADFVYALDKNGALKVRTTFQPDTAIVKSXARLGLTFRXADAYNQVSYLGRGDHETYIDRNQSGRIGLYDTT VERXFHYYATPQSTANRTDVRWAKLTDQAGEGVFXESNRPFQFSIIPFSDVLLEKAHHINELERDGXITIHLDAEQAGVG TATCGPGVLPQYLVPVKKQSFEFTLYPVKE
Domain History Events (42)
Domain assignment manual match h by cuff on 06 Feb 2009 15:17
same superfamily
Homcheck allotment by cuff on 06 Feb 2009 15:15
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by cuff on 06 Feb 2009 15:15
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 29 Oct 2008 00:20
Domain "3bgaA05" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 29 Oct 2008 00:20
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3bgaA05
Flow stage update by auto on 29 Oct 2008 00:09
Retrieved PRC_PFAMCATH results for job ID SID6456103438804217 and results inserted.
Domain scan prc pfamcath by auto on 29 Oct 2008 00:08
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 1 results for 3bgaA05
Update comment by auto on 28 Oct 2008 07:40
PRC_PFAMCATH job SID6456103438804217 is not yet finished.
Flow stage update by auto on 28 Oct 2008 07:31
The entry "3bgaA05" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 28 Oct 2008 07:31
The entry "3bgaA05" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 28 Oct 2008 06:57
Retrieved SSAP results for job ID SID3961198754052308 and results inserted.
Domain scan ssap cath by auto on 28 Oct 2008 06:56
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 30 results for 3bgaA05
Update comment by auto on 23 Oct 2008 21:23
SSAP job SID3961198754052308 is not yet finished.
Ssap cath submit by auto on 23 Oct 2008 20:55
The entry "3bgaA05" has been submitted to the SSAP webservice.
Flow stage update by auto on 23 Oct 2008 20:55
The entry "3bgaA05" has been submitted to the SSAP webservice.
Flow stage update by auto on 23 Oct 2008 20:37
Retrieved PRC results for job ID SID4713792701853007 and inserted them into the database.
Domain scan prc cath by auto on 23 Oct 2008 20:37
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 3bgaA05
Update comment by auto on 23 Oct 2008 14:56
PRC job SID4713792701853007 is not yet finished.
Prc cath submit by auto on 23 Oct 2008 14:47
The entry "3bgaA05" has been submitted to the PRC webservice.
Flow stage update by auto on 23 Oct 2008 14:47
The entry "3bgaA05" has been submitted to the PRC webservice.
Flow stage update by auto on 23 Oct 2008 14:36
Retrieved HMM(SAM) results for job ID SID9176842684620000 and inserted them into the database.
Domain scan sam cath by auto on 23 Oct 2008 14:36
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 3bgaA05
Update comment by auto on 23 Oct 2008 06:27
HMM(SAM) job SID9176842684620000 is not yet finished.
Sam cath submit by auto on 23 Oct 2008 06:13
The entry "3bgaA05" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 23 Oct 2008 06:13
The entry "3bgaA05" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 23 Oct 2008 05:38
Retrieved "3bgaA05" CATHEDRAL results for job ID SID5305483849896765 and inserted them into the database.
Domain scan cathedral cath by auto on 23 Oct 2008 05:37
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 144 results for 3bgaA05
Update comment by auto on 22 Oct 2008 14:43
"3bgaA05" CATHEDRAL job SID5305483849896765 is not yet finished.
Cathedral cath submit by auto on 22 Oct 2008 14:37
The entry "3bgaA05" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 22 Oct 2008 14:37
The entry "3bgaA05" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 22 Oct 2008 14:26
ScanList with 12259 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3bgaA05.scanlist" for "3bgaA05"
Write scan list by auto on 22 Oct 2008 14:26
Writing ScanList containing 12259 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3bgaA05.scanlist" for domain "3bgaA05"
Update comment by auto on 22 Oct 2008 11:51
Waiting for 14 new domains (example : 3dgvA01) to be processed so that they can be scanned against too.
Update comment by auto on 22 Oct 2008 09:11
Waiting for 42 new domains (example : 3cb5B01) to be processed so that they can be scanned against too.
Update comment by auto on 22 Oct 2008 06:03
Waiting for 73 new domains (example : 3bjeA01) to be processed so that they can be scanned against too.
Flow stage update by auto on 22 Oct 2008 06:01
No satisfactory AssignClose result found.
Flow stage update by auto on 22 Oct 2008 05:26
No in_process hits for Domain "3bgaA05" ready to be processed
Flow stage update by auto on 22 Oct 2008 05:26
NW result present for Domain "3bgaA05"
Flow stage update by auto on 21 Oct 2008 08:34
All required files are present for Domain "3bgaA05"
Flow stage update by auto on 20 Oct 2008 18:49
Beginning processing for Domain "3bgaA05"
Insertion by cuff on 20 Oct 2008 16:51
nice chopping
