CATH Domain: 3bgaA04 XML data for domain: 3bgaA04

Molscript image for 3bgaA04
3bgaA04
PDB coordinates for domain 3bgaA04

PDB 3bga, Chain A, Domain 4

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.60 Sandwich
2.60.40 Immunoglobulin-like
2.60.40.320 Gene3D
2.60.40.320.7
2.60.40.320.7.1
2.60.40.320.7.1.1
2.60.40.320.7.1.1.1
2.60.40.320.7.1.1.1.1

[top]
Segment boundaries for domain 3bgaA04

Chopping figure for domain 3bgaA04
DomainStart PDB ResidueStop PDB Residue
3bgaA01 27 245
3bgaA02 246 356
3bgaA03 357 637
3bgaA04 638 742
3bgaA05 754 1023

Structural Neighbourhood (17 entries)

There are 17 matching structural neighberhood comparisons for CATH ID 2.60.40.320.7.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 17 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ifrA00 78.62 Perinuclear region of cytoplasmMuscle organ developmentLamin-A/CStructural molecule activityHomo sapiens 2.60.40.1260 113 10 73 2.87 3.91
1ze3C01 78.14 Fimbrial chaperone proteinChaperone protein fimCEscherichia coli K-12 2.60.40.360 117 10 82 4.10 5.00
1ok8A04 77.92 Dengue virus 2 Puerto Rico/PR159-S1/1969Genome polyprotein 2.60.40.350 100 5 79 3.09 3.91
1p5uA02 76.42 Yersinia pestisChaperone protein caf1MProtein binding 2.60.40.1070 84 14 72 3.27 4.52
3cfuB00 76.36 Bacillus subtilisUncharacterized lipoprotein yjhA 2.60.40.1240 131 6 74 3.66 4.89
2g30A01 76.28 AP-2 complex subunit betaHomo sapiensProtein binding 2.60.40.1150 117 9 76 3.80 5.00
1ayoA00 75.71 Bos taurusAlpha-2-macroglobulinAlpha-2-macroglobulinComplement and coagulation cascades 2.60.40.690 130 6 73 3.02 4.13
1svbA04 75.20 Genome polyproteinTick-borne encephalitis virus (WESTERN SUBTYPE) 2.60.40.350 96 1 73 3.30 4.50
1dceA02 75.05 Rattus norvegicusRab geranylgeranyltransferase activityProtein geranylgeranyltransferase type II [EC:2.5.1.60]Geranylgeranyl transferase type-2 subunit alpha 2.60.40.1130 103 10 82 3.94 4.76
1ulvA03 75.00 GlucodextranaseArthrobacter globiformis 2.60.40.1560 86 8 72 3.10 4.28
3fbqA02 74.77 Bacillus anthracisConserved domain protein 2.60.40.1640 139 11 73 3.64 4.96
1nepA00 74.68 LysosomeBos taurusNiemann-Pick C2 proteinEpididymal secretory protein E1 2.60.40.770 130 5 72 3.43 4.74
1f00I01 74.52 Pathogenic Escherichia coli infectionIntiminIntiminProtein bindingEscherichia coli O127:H6 str. E2348/69 2.60.40.920 95 4 79 3.21 4.06
1cwvA03 73.79 InvasinYersinia pseudotuberculosis 2.60.40.920 102 5 78 3.89 4.98
1ufgA00 73.67 Lamin-A/CNuclear envelope organizationDilated cardiomyopathyVentricular cardiac muscle cell developmentProtein binding 2.60.40.1260 151 13 56 2.77 4.92
1b4rA00 72.75 Integral to plasma membranePolycystin-1Homophilic cell adhesionHomo sapiensProtein binding 2.60.40.670 80 6 74 3.52 4.74
2nt0A02 70.10 GlucosylceramidaseProtein bindingSphingolipid metabolismGlucosylceramidase [EC:3.2.1.45]Metabolic pathways 2.60.40.1180 109 5 49 2.44 4.93
[1]
Displaying entries 1 to 17 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3bgaA04
QNIKATLSDRKNLKVCIKNWYDFSNLNEYILRWNVKGEDGTVLAEGTKEVDCEPHATVDVTLGAVKLPNTVREAYLNLSW
SRKEATPLVDTDWEVAYDQFVLAGN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3bgaA04
QNIKATLSDRKNLKVCIKNWYDFSNLNEYILRWNVKGEDGTVLAEGTKEVDCEPHATVDVTLGAVKLPNTVREAYLNLSW
SRKEATPLVDTDWEVAYDQFVLAGN
BLAST against CATH

[top]
Domain History Events (43)

Domain assigned by cuff on 11 Feb 2009 20:42

homology match

Domain assignment manual match h by cuff on 11 Feb 2009 20:40

same superfamily

Homcheck allotment by cuff on 06 Feb 2009 15:08

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 06 Feb 2009 15:08

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 28 Oct 2008 19:31

Domain "3bgaA04" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 28 Oct 2008 19:31

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3bgaA04

Flow stage update by auto on 28 Oct 2008 19:07

Retrieved PRC_PFAMCATH results for job ID SID4215294670844974 and results inserted.

Domain scan prc pfamcath by auto on 28 Oct 2008 19:06

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 1 results for 3bgaA04

Update comment by auto on 27 Oct 2008 14:47

PRC_PFAMCATH job SID4215294670844974 is not yet finished.

Prc pfamcath submit by auto on 27 Oct 2008 14:42

The entry "3bgaA04" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 27 Oct 2008 14:42

The entry "3bgaA04" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 27 Oct 2008 14:38

Retrieved SSAP results for job ID SID1494982875642832 and results inserted.

Domain scan ssap cath by auto on 27 Oct 2008 14:34

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2590 results for 3bgaA04

Update comment by auto on 23 Oct 2008 21:23

SSAP job SID1494982875642832 is not yet finished.

Ssap cath submit by auto on 23 Oct 2008 20:55

The entry "3bgaA04" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Oct 2008 20:55

The entry "3bgaA04" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Oct 2008 20:39

Retrieved PRC results for job ID SID6027563809285184 and inserted them into the database.

Domain scan prc cath by auto on 23 Oct 2008 20:38

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 3bgaA04

Update comment by auto on 23 Oct 2008 14:56

PRC job SID6027563809285184 is not yet finished.

Prc cath submit by auto on 23 Oct 2008 14:48

The entry "3bgaA04" has been submitted to the PRC webservice.

Flow stage update by auto on 23 Oct 2008 14:48

The entry "3bgaA04" has been submitted to the PRC webservice.

Flow stage update by auto on 23 Oct 2008 14:37

Retrieved HMM(SAM) results for job ID SID7662720124848048 and inserted them into the database.

Domain scan sam cath by auto on 23 Oct 2008 14:37

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 3bgaA04

Update comment by auto on 22 Oct 2008 23:52

HMM(SAM) job SID7662720124848048 is not yet finished.

Sam cath submit by auto on 22 Oct 2008 23:47

The entry "3bgaA04" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Oct 2008 23:47

The entry "3bgaA04" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Oct 2008 23:40

Retrieved "3bgaA04" CATHEDRAL results for job ID SID5350576728209096 and inserted them into the database.

Domain scan cathedral cath by auto on 22 Oct 2008 23:40

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 194 results for 3bgaA04

Update comment by auto on 22 Oct 2008 14:43

"3bgaA04" CATHEDRAL job SID5350576728209096 is not yet finished.

Cathedral cath submit by auto on 22 Oct 2008 14:37

The entry "3bgaA04" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Oct 2008 14:37

The entry "3bgaA04" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Oct 2008 14:27

ScanList with 12259 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3bgaA04.scanlist" for "3bgaA04"

Write scan list by auto on 22 Oct 2008 14:27

Writing ScanList containing 12259 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3bgaA04.scanlist" for domain "3bgaA04"

Update comment by auto on 22 Oct 2008 11:51

Waiting for 14 new domains (example : 3dgvA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Oct 2008 09:11

Waiting for 42 new domains (example : 3cb5B01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Oct 2008 06:03

Waiting for 73 new domains (example : 3bjeA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Oct 2008 01:58

Waiting for 121 new domains (example : 3bgaA05) to be processed so that they can be scanned against too.

Flow stage update by auto on 21 Oct 2008 23:25

No satisfactory AssignClose result found.

Flow stage update by auto on 21 Oct 2008 23:07

No in_process hits for Domain "3bgaA04" ready to be processed

Flow stage update by auto on 21 Oct 2008 23:07

NW result present for Domain "3bgaA04"

Flow stage update by auto on 21 Oct 2008 08:34

All required files are present for Domain "3bgaA04"

Flow stage update by auto on 20 Oct 2008 18:49

Beginning processing for Domain "3bgaA04"

Insertion by cuff on 20 Oct 2008 16:51

nice chopping