CATH Domain: 3bgaA02 XML data for domain: 3bgaA02

Molscript image for 3bgaA02
3bgaA02
PDB coordinates for domain 3bgaA02

PDB 3bga, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.60 Sandwich
2.60.40 Immunoglobulin-like
2.60.40.320 Gene3D
2.60.40.320.5
2.60.40.320.5.1
2.60.40.320.5.1.1
2.60.40.320.5.1.1.1
2.60.40.320.5.1.1.1.1

[top]
Segment boundaries for domain 3bgaA02

Chopping figure for domain 3bgaA02
DomainStart PDB ResidueStop PDB Residue
3bgaA01 27 245
3bgaA02 246 356
3bgaA03 357 637
3bgaA04 638 742
3bgaA05 754 1023

Structural Neighbourhood (22 entries)

There are 22 matching structural neighberhood comparisons for CATH ID 2.60.40.320.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 22 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3cmgA02 86.22 Putative beta-galactosidaseBacteroides fragilis NCTC 9343 2.60.40.320 118 16 88 1.64 1.86
3bgaA04 79.78 Galactose metabolismBacteroides thetaiotaomicronBeta-galactosidaseSphingolipid metabolismBeta-galactosidase [EC:3.2.1.23] 2.60.40.320 105 7 82 2.90 3.50
1ifrA00 79.05 Perinuclear region of cytoplasmMuscle organ developmentLamin-A/CStructural molecule activityHomo sapiens 2.60.40.1260 113 7 69 3.04 4.40
1ze3C01 78.66 Fimbrial chaperone proteinChaperone protein fimCEscherichia coli K-12 2.60.40.360 117 9 86 3.70 4.29
2pr9A02 78.64 Huntington's diseaseEndocytosisRattus norvegicusClathrin vesicle coatAP-2 complex subunit mu-1 2.60.40.1170 112 2 83 3.78 4.55
2xg5A01 78.10 Chaperone protein PapDChaperone protein papDEscherichia coli 2.60.40.360 121 5 84 3.51 4.16
1dqiA00 77.66 Pyrococcus furiosusSuperoxide reductaseSuperoxide reductase [EC:1.15.1.2] 2.60.40.730 124 6 72 3.29 4.53
2r5oA01 77.04 Putative ATP binding component of ABC-transporterEscherichia coli 2.70.50.60 151 9 64 2.10 3.27
1xvsA00 76.96 Vibrio choleraeProtein ApaGApaG protein 2.60.40.1470 120 9 81 3.59 4.40
1f00I01 76.77 Pathogenic Escherichia coli infectionIntiminIntiminProtein bindingEscherichia coli O127:H6 str. E2348/69 2.60.40.920 95 10 78 3.69 4.71
2qfpA01 76.71 Fe(3+)-Zn(2+) purple acid phosphatasePhaseolus vulgaris 2.60.40.380 97 6 80 3.81 4.75
1cwvA02 76.30 InvasinYersinia pseudotuberculosis 2.60.40.920 97 6 79 3.73 4.70
1uunA01 76.19 Mycobacterium smegmatisMspA 2.60.40.1650 132 7 80 3.65 4.55
1im3D00 76.19 Unique short US2 glycoproteinHuman herpesvirus 5 strain AD169 2.60.40.1200 95 12 79 3.06 3.86
1eaqB00 75.95 Skeletal system developmentCentral nervous system developmentBehavioral response to painEmbryonic hemopoiesisProtein binding 2.60.40.720 122 4 75 3.34 4.43
1ulvA03 75.77 GlucodextranaseArthrobacter globiformis 2.60.40.1560 86 6 70 3.16 4.50
1svbA04 75.71 Genome polyproteinTick-borne encephalitis virus (WESTERN SUBTYPE) 2.60.40.350 96 8 72 3.38 4.69
1kmtA00 75.46 Anti-apoptosisCellular component movementIdentical protein bindingCytoskeletonNeurotrophin signaling pathway 2.70.50.30 138 4 69 3.19 4.59
1nepA00 75.37 LysosomeBos taurusNiemann-Pick C2 proteinEpididymal secretory protein E1 2.60.40.770 130 9 72 3.50 4.84
1ok8A04 74.97 Dengue virus 2 Puerto Rico/PR159-S1/1969Genome polyprotein 2.60.40.350 100 7 77 3.84 4.96
1ayoA00 74.83 Bos taurusAlpha-2-macroglobulinAlpha-2-macroglobulinComplement and coagulation cascades 2.60.40.690 130 9 75 3.67 4.87
2a9dA02 74.63 Sulfite oxidaseGallus gallus 2.60.40.650 123 6 73 3.62 4.89
[1]
Displaying entries 1 to 22 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3bgaA02
QYIADYKVSASLDKEKYKEGIFNLEVTVEGPSATASSIAYTLKDASGKAVLQDAINIKSRGLSNFIAFDEKKIAEVKAWN
AEHPNLYTLVLELKDAQGKVTELTGCEVGFR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3bgaA02
QYIADYKVSASLDKEKYKEGIFNLEVTVEGPSATASSIAYTLKDASGKAVLQDAINIKSRGLSNFIAFDEKKIAEVKAWN
AEHPNLYTLVLELKDAQGKVTELTGCEVGFR
BLAST against CATH

[top]
Domain History Events (43)

Domain assigned by cuff on 06 Feb 2009 15:07

homology match

Domain assignment manual match h by cuff on 06 Feb 2009 14:59

same superfamily

Homcheck allotment by cuff on 06 Feb 2009 14:58

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 06 Feb 2009 14:58

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 28 Oct 2008 19:31

Domain "3bgaA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 28 Oct 2008 19:31

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3bgaA02

Flow stage update by auto on 28 Oct 2008 19:06

Retrieved PRC_PFAMCATH results for job ID SID9715936051921536 and results inserted.

Domain scan prc pfamcath by auto on 28 Oct 2008 19:06

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 2 results for 3bgaA02

Update comment by auto on 27 Oct 2008 09:00

PRC_PFAMCATH job SID9715936051921536 is not yet finished.

Flow stage update by auto on 27 Oct 2008 08:55

The entry "3bgaA02" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 27 Oct 2008 08:55

The entry "3bgaA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 27 Oct 2008 08:45

Retrieved SSAP results for job ID SID0229054588813912 and results inserted.

Domain scan ssap cath by auto on 27 Oct 2008 08:40

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2321 results for 3bgaA02

Update comment by auto on 23 Oct 2008 21:23

SSAP job SID0229054588813912 is not yet finished.

Flow stage update by auto on 23 Oct 2008 20:55

The entry "3bgaA02" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 23 Oct 2008 20:55

The entry "3bgaA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Oct 2008 20:38

Retrieved PRC results for job ID SID1328641868971120 and inserted them into the database.

Domain scan prc cath by auto on 23 Oct 2008 20:37

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 3 results for 3bgaA02

Update comment by auto on 23 Oct 2008 14:56

PRC job SID1328641868971120 is not yet finished.

Prc cath submit by auto on 23 Oct 2008 14:48

The entry "3bgaA02" has been submitted to the PRC webservice.

Flow stage update by auto on 23 Oct 2008 14:48

The entry "3bgaA02" has been submitted to the PRC webservice.

Flow stage update by auto on 23 Oct 2008 14:37

Retrieved HMM(SAM) results for job ID SID2713056321493984 and inserted them into the database.

Domain scan sam cath by auto on 23 Oct 2008 14:36

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 3 results for 3bgaA02

Update comment by auto on 22 Oct 2008 23:52

HMM(SAM) job SID2713056321493984 is not yet finished.

Sam cath submit by auto on 22 Oct 2008 23:47

The entry "3bgaA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Oct 2008 23:47

The entry "3bgaA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Oct 2008 23:40

Retrieved "3bgaA02" CATHEDRAL results for job ID SID1739645434688040 and inserted them into the database.

Domain scan cathedral cath by auto on 22 Oct 2008 23:39

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 194 results for 3bgaA02

Update comment by auto on 22 Oct 2008 14:43

"3bgaA02" CATHEDRAL job SID1739645434688040 is not yet finished.

Cathedral cath submit by auto on 22 Oct 2008 14:37

The entry "3bgaA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Oct 2008 14:37

The entry "3bgaA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Oct 2008 14:27

ScanList with 12259 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3bgaA02.scanlist" for "3bgaA02"

Write scan list by auto on 22 Oct 2008 14:26

Writing ScanList containing 12259 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3bgaA02.scanlist" for domain "3bgaA02"

Update comment by auto on 22 Oct 2008 11:51

Waiting for 14 new domains (example : 3dgvA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Oct 2008 09:11

Waiting for 42 new domains (example : 3cb5B01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Oct 2008 06:03

Waiting for 73 new domains (example : 3bjeA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Oct 2008 01:58

Waiting for 121 new domains (example : 3bgaA05) to be processed so that they can be scanned against too.

Flow stage update by auto on 21 Oct 2008 23:25

No satisfactory AssignClose result found.

Flow stage update by auto on 21 Oct 2008 23:07

No in_process hits for Domain "3bgaA02" ready to be processed

Flow stage update by auto on 21 Oct 2008 23:07

NW result present for Domain "3bgaA02"

Flow stage update by auto on 21 Oct 2008 08:34

All required files are present for Domain "3bgaA02"

Flow stage update by auto on 20 Oct 2008 18:49

Beginning processing for Domain "3bgaA02"

Insertion by cuff on 20 Oct 2008 16:51

nice chopping