CATH Domain: 3bg2A01 XML data for domain: 3bg2A01

Molscript image for 3bg2A01
3bg2A01
PDB coordinates for domain 3bg2A01

PDB 3bg2, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.3210 Hypothetical protein af1432
1.10.3210.10 Hypothetical protein af1432 Gene3D
1.10.3210.10.5
1.10.3210.10.5.1
1.10.3210.10.5.1.1
1.10.3210.10.5.1.1.1
1.10.3210.10.5.1.1.1.1

[top]
Segment boundaries for domain 3bg2A01

Chopping figure for domain 3bg2A01
DomainStart PDB ResidueStop PDB Residue
3bg2A01 2 120
3bg2A01 157 244
3bg2A02 121 156
3bg2A02 360 441
3bg2A03 245 359

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|3bg2A01
MNWEHLLSLKRQGDTAKRLRIEQDDTRLGFEVDYDRIIFSAPFRSLQDKTQVIPTDFVHTRLTHSLEVSVVGRSLGRMVG
KKLLEKYPHLEQVYGYKFNDFGAIVAAAALAHDIGNKFEGNANGFKVLSQSKPGAQGGLRLSYATLGAFMKYPKESLKYG
FFQSERALFEDVAQELGLLKRDVSWSRHP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3bg2A01
MMNWEHLLSLKRQGDTAKRLRIEQDDTRLGFEVDYDRIIFSAPFRSLQDKTQVIPLSKTDFVHTRLTHSLEVSVVGRSLG
RMVGKKLLEKYPHLEQVYGYKFNDFGAIVAAAALAHDIGNKFEGNANGFKVLSQSKPGAQGGLRLSYATLGAFMKYPKES
LPHKPSDHIADKKYGFFQSERALFEDVAQELGLLKRSTTDDVSWSRHP
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 18 May 2009 17:27

Assigning to "1.10.3210.10" based on similarity with "2pgsA01"

Flow stage update by auto on 18 May 2009 17:09

No in_process hits for Domain "3bg2A01" ready to be processed

Update comment by auto on 21 Oct 2008 23:09

Domain "3bg2A01" hits Domain "2pgsA01" (47.0588235294118% over 94.2307692307692%) which is currently in process

Flow stage update by auto on 21 Oct 2008 23:07

Domain "3bg2A01" hits Domain "2pgsA01" (47.0588235294118% over 94.2307692307692%) which is currently in process

Flow stage update by auto on 21 Oct 2008 23:07

NW result present for Domain "3bg2A01"

Flow stage update by auto on 21 Oct 2008 08:34

All required files are present for Domain "3bg2A01"

Flow stage update by auto on 20 Oct 2008 18:49

Beginning processing for Domain "3bg2A01"

Insertion by cuff on 20 Oct 2008 16:51

nice chopping