CATH Domain: 3bfmA01 XML data for domain: 3bfmA01

Molscript image for 3bfmA01
3bfmA01
PDB coordinates for domain 3bfmA01

PDB 3bfm, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.930 BirA Bifunctional Protein; domain 2
3.30.930.10 Bira Bifunctional Protein; Domain 2 Gene3D
3.30.930.10.17
3.30.930.10.17.1
3.30.930.10.17.1.1
3.30.930.10.17.1.1.1
3.30.930.10.17.1.1.1.1

[top]
Segment boundaries for domain 3bfmA01

Chopping figure for domain 3bfmA01
DomainStart PDB ResidueStop PDB Residue
3bfmA01 12 190
3bfmA02 191 233

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.930.10.17.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1hxdA02 83.18 Biotin metabolismBirA family transcriptional regulator, biotin operon repressor / biotin-[acetyl-CoA-carboxylase] ligase [EC:6.3.4.15]Biotin biosynthetic processProtein bindingEscherichia coli K-12 3.30.930.10 197 12 81 2.52 3.08
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3bfmA01
TGEAAGPGQDPFDLACQKAELGVDAGLVVYELGTDVLRAALVLAPEVPLAKAALPVCGVGFQNALGALAPPEVAVHLDWN
GALRINGARCGRLRIAASTDDPDTQPDWLVVGLDLPLWPEGDGGETPDETALYAEGCADVAAPRLLESWARHCLHWINRW
DEGELETIHGEWRGLAH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3bfmA01
TGEAAGPGQDPFDLACQKAELGVDAGLVVYELGTDVLRAALVLAPEVPLAKAXAXLPVCGVGFQNALGALAPPEVAVHLD
WNGALRINGARCGRLRIAASTDDPDTQPDWLVVGLDLPLWPEGDGGETPDETALYAEGCADVAAPRLLESWARHCLHWIN
RWDEGELETIHGEWRGLAH
BLAST against CATH

[top]
Domain History Events (81)

Domain assigned by cuff on 24 Mar 2009 19:30

same superfamily

Domain assignment manual match h by cuff on 24 Mar 2009 19:27

homology match

Homcheck allotment by cuff on 24 Mar 2009 19:24

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 24 Mar 2009 19:24

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 16 Mar 2009 06:47

Domain "3bfmA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 16 Mar 2009 06:47

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3bfmA01

Flow stage update by auto on 16 Mar 2009 03:52

Retrieved PRC_PFAMCATH results for job ID SID3836053035963584 and results inserted.

Domain scan prc pfamcath by auto on 16 Mar 2009 03:51

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 5 results for 3bfmA01

Update comment by auto on 15 Mar 2009 18:54

PRC_PFAMCATH job SID3836053035963584 is not yet finished.

Prc pfamcath submit by auto on 15 Mar 2009 18:43

The entry "3bfmA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Mar 2009 18:43

The entry "3bfmA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 15 Mar 2009 18:21

Retrieved SSAP results for job ID SID8135821247679808 and results inserted.

Domain scan ssap cath by auto on 15 Mar 2009 18:17

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1462 results for 3bfmA01

Update comment by auto on 10 Mar 2009 02:35

SSAP job SID8135821247679808 is not yet finished.

Flow stage update by auto on 10 Mar 2009 02:23

The entry "3bfmA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 10 Mar 2009 02:23

The entry "3bfmA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Mar 2009 01:52

Retrieved PRC results for job ID SID9528328483644448 and inserted them into the database.

Domain scan prc cath by auto on 10 Mar 2009 01:51

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 3 results for 3bfmA01

Update comment by auto on 09 Mar 2009 20:01

PRC job SID9528328483644448 is not yet finished.

Prc cath submit by auto on 09 Mar 2009 19:46

The entry "3bfmA01" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Mar 2009 19:46

The entry "3bfmA01" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Mar 2009 19:09

Retrieved HMM(SAM) results for job ID SID3803166049159072 and inserted them into the database.

Domain scan sam cath by auto on 09 Mar 2009 19:09

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 3bfmA01

Update comment by auto on 04 Mar 2009 16:11

HMM(SAM) job SID3803166049159072 is not yet finished.

Sam cath submit by auto on 04 Mar 2009 16:01

The entry "3bfmA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Mar 2009 16:01

The entry "3bfmA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Mar 2009 12:39

Unable to retrieve "3bfmA01" HMM(SAM) results for job "SID3443629398946480"

Update comment by auto on 04 Mar 2009 04:15

HMM(SAM) job SID3443629398946480 is not yet finished.

Flow stage update by auto on 04 Mar 2009 04:02

The entry "3bfmA01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 04 Mar 2009 04:02

The entry "3bfmA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 04 Mar 2009 01:00

Unable to retrieve "3bfmA01" HMM(SAM) results for job "SID7864392999503360"

Sam cath submit by auto on 03 Mar 2009 23:34

The entry "3bfmA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Mar 2009 23:34

The entry "3bfmA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 15:55

Unable to retrieve "3bfmA01" HMM(SAM) results for job "SID3012976797209136"

Flow stage update by auto on 19 Feb 2009 15:19

The entry "3bfmA01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 19 Feb 2009 15:19

The entry "3bfmA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 19 Feb 2009 12:49

Retrieved "3bfmA01" CATHEDRAL results for job ID SID0129154843296944 and inserted them into the database.

Domain scan cathedral cath by auto on 19 Feb 2009 12:48

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 71 results for 3bfmA01

Update comment by auto on 19 Feb 2009 07:39

"3bfmA01" CATHEDRAL job SID0129154843296944 is not yet finished.

Flow stage update by auto on 19 Feb 2009 06:23

The entry "3bfmA01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 19 Feb 2009 06:23

The entry "3bfmA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 27 Jan 2009 11:59

Unable to retrieve "3bfmA01" CATHEDRAL results for job "SID0269180142910552"

Update comment by auto on 22 Jan 2009 17:09

"3bfmA01" CATHEDRAL job SID0269180142910552 is not yet finished.

Cathedral cath submit by auto on 22 Jan 2009 16:38

The entry "3bfmA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Jan 2009 16:38

The entry "3bfmA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 21 Dec 2008 14:59

ScanList with 12830 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3bfmA01.scanlist" for "3bfmA01"

Write scan list by auto on 21 Dec 2008 14:59

Writing ScanList containing 12830 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3bfmA01.scanlist" for domain "3bfmA01"

Update comment by auto on 21 Dec 2008 11:52

Waiting for 76 new domains (example : 3davB00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 20:42

Waiting for 113 new domains (example : 3bmkB00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 19:04

Waiting for 148 new domains (example : 3bllA00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 14:36

Waiting for 197 new domains (example : 2vmtA02) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 11:35

Waiting for 239 new domains (example : 2jknF00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 07:50

Waiting for 256 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 03:58

Waiting for 248 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 20 Dec 2008 00:49

Waiting for 246 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 19 Dec 2008 20:43

Waiting for 197 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 19 Dec 2008 16:55

Waiting for 189 new domains (example : 2jkjA00) to be processed so that they can be scanned against too.

Update comment by auto on 19 Dec 2008 11:34

Waiting for 32 new domains (example : 2jknA00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 23:33

Waiting for 2 new domains (example : 3fcxA00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 22:12

Waiting for 27 new domains (example : 3ex7B00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 17:38

Waiting for 80 new domains (example : 2zecD01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 14:52

Waiting for 132 new domains (example : 2zebD01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 11:32

Waiting for 174 new domains (example : 2zebD01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 09:47

Waiting for 227 new domains (example : 2w42B01) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 04:25

Waiting for 270 new domains (example : 2rklB00) to be processed so that they can be scanned against too.

Update comment by auto on 17 Dec 2008 00:27

Waiting for 285 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 20:35

Waiting for 267 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 18:32

Waiting for 261 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 14:43

Waiting for 215 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 16 Dec 2008 10:54

Waiting for 201 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Dec 2008 20:40

Waiting for 150 new domains (example : 2jldA01) to be processed so that they can be scanned against too.

Update comment by auto on 15 Dec 2008 17:13

Waiting for 297 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Dec 2008 20:41

Waiting for 337 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 14 Dec 2008 17:19

Waiting for 547 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Update comment by auto on 13 Dec 2008 20:37

Waiting for 598 new domains (example : 2r6gG01) to be processed so that they can be scanned against too.

Flow stage update by auto on 13 Dec 2008 20:35

No satisfactory AssignClose result found.

Flow stage update by auto on 13 Dec 2008 20:14

No in_process hits for Domain "3bfmA01" ready to be processed

Flow stage update by auto on 13 Dec 2008 20:14

NW result present for Domain "3bfmA01"

Flow stage update by auto on 10 Dec 2008 14:16

All required files are present for Domain "3bfmA01"

Flow stage update by auto on 10 Dec 2008 14:14

Beginning processing for Domain "3bfmA01"

Insertion by cuff on 08 Dec 2008 12:31

nice chopping