Domain assigned by auto on 18 Feb 2009 20:08
Assigning to "3.90.226.10" based on similarity with "3bf0D03"
CATH Domain: 3bf0C03
3bf0C03
PDB 3bf0, Chain C, Domain 3
Segment boundaries for domain 3bf0C03
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 3bf0C01 | 56 | 178 |
| 3bf0C01 | 221 | 318 |
| 3bf0C02 | 189 | 220 |
| 3bf0C02 | 433 | 498 |
| 3bf0C03 | 319 | 432 |
| 3bf0C03 | 499 | 551 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|3bf0C03 KTPADTGDSIGVVFANGAIMDGEETQGNVGGDTTAAQIRDARLDPKVKAIVLRVNSPGGSVTASEVIRAELAAARAAGKP VVVSMGGMAASGGYWISTPANYIVANPSTLTGSITPEQIDKIAQGHVWTGQDAKANGLVDSLGDFDDAVAKAAELAKVKQ WHLEYYV
Domain History Events (11)
Flow stage update by auto on 18 Feb 2009 19:41
No in_process hits for Domain "3bf0C03" ready to be processed
Update comment by auto on 18 Feb 2009 19:15
Domain "3bf0C03" hits Domain "3bf0D03" (100% over 98.8023952095808%) which is currently in process
Update comment by auto on 18 Feb 2009 18:47
Domain "3bf0C03" hits Domain "3bf0B03" (100% over 98.8023952095808%) which is currently in process
Update comment by auto on 18 Feb 2009 18:15
Domain "3bf0C03" hits Domain "3bf0A03" (100% over 98.8023952095808%) which is currently in process
Update comment by auto on 21 Oct 2008 23:09
Domain "3bf0C03" hits Domain "3bezD03" (98.2035928143713% over 100%) which is currently in process
Flow stage update by auto on 21 Oct 2008 23:07
Domain "3bf0C03" hits Domain "3bezD03" (98.2035928143713% over 100%) which is currently in process
Flow stage update by auto on 21 Oct 2008 23:07
NW result present for Domain "3bf0C03"
Flow stage update by auto on 21 Oct 2008 08:34
All required files are present for Domain "3bf0C03"
Flow stage update by auto on 20 Oct 2008 18:49
Beginning processing for Domain "3bf0C03"
Insertion by auto on 20 Oct 2008 17:24
Final ChopClose added based on similarity with "3bf0A"
