Domain assigned by cuff on 06 Feb 2009 13:52
same superfamily
There are 1 matching structural neighberhood comparisons for CATH ID 1.25.40.10.17.1.1.1.1 (SIMAX score < 5)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
![]() |
2r5sA01 | 80.56 | 1.25.40.10 | 82 | 8 | 87 | 3.42 | 3.90 |
>pdb|3beeA00 NAVTATQLAAKATTLYYLHKQATDEVSLLLEQALQLEPYNEAALSLIANDHFISFRFQEAIDTWVLLLDSNDPNLDRVTI IESINKAKKL
same superfamily
homology match
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Domain "3beeA00" SCOP scan with no results - no SCOP mapping
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3beeA00
Retrieved PRC_PFAMCATH results for job ID SID7291284159815915 and results inserted.
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 115 results for 3beeA00
PRC_PFAMCATH job SID7291284159815915 is not yet finished.
The entry "3beeA00" has been submitted to the PRC_PFAMCATH webservice.
The entry "3beeA00" has been submitted to the PRC_PFAMCATH webservice.
Retrieved SSAP results for job ID SID5376045454945856 and results inserted.
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 3594 results for 3beeA00
SSAP job SID5376045454945856 is not yet finished.
The entry "3beeA00" has been submitted to the SSAP webservice.
The entry "3beeA00" has been submitted to the SSAP webservice.
Retrieved PRC results for job ID SID0313489097281272 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 29 results for 3beeA00
PRC job SID0313489097281272 is not yet finished.
The entry "3beeA00" has been submitted to the PRC webservice.
The entry "3beeA00" has been submitted to the PRC webservice.
Retrieved HMM(SAM) results for job ID SID3926475971400232 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 3beeA00
HMM(SAM) job SID3926475971400232 is not yet finished.
The entry "3beeA00" has been submitted to the HMM (SAM) webservice.
The entry "3beeA00" has been submitted to the HMM (SAM) webservice.
Retrieved "3beeA00" CATHEDRAL results for job ID SID4520881105518074 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 167 results for 3beeA00
"3beeA00" CATHEDRAL job SID4520881105518074 is not yet finished.
The entry "3beeA00" has been submitted to the CATHEDRAL webservice.
The entry "3beeA00" has been submitted to the CATHEDRAL webservice.
ScanList with 12259 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3beeA00.scanlist" for "3beeA00"
Writing ScanList containing 12259 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3beeA00.scanlist" for domain "3beeA00"
Waiting for 14 new domains (example : 3dgvA01) to be processed so that they can be scanned against too.
Waiting for 42 new domains (example : 3cb5B01) to be processed so that they can be scanned against too.
Waiting for 73 new domains (example : 3bjeA01) to be processed so that they can be scanned against too.
Waiting for 121 new domains (example : 3bgaA05) to be processed so that they can be scanned against too.
Waiting for 174 new domains (example : 3beeB00) to be processed so that they can be scanned against too.
No satisfactory AssignClose result found.
No in_process hits for Domain "3beeA00" ready to be processed
NW result present for Domain "3beeA00"
All required files are present for Domain "3beeA00"
Beginning processing for Domain "3beeA00"
nice chopping