Domain assigned by cuff on 06 Feb 2009 13:52
same superfamily
CATH Domain: 3beeA00
3beeA00
PDB 3bee, Chain A, Domain 0
Structural Neighbourhood (1 entries)
There are 1 matching structural neighberhood comparisons for CATH ID 1.25.40.10.14.1.1.1.1 (SIMAX score < 5)
[1]
Displaying entries 1 to 1 (page 1 of 1)
| Match Depth | Match | SSAP score | Match Keywords | Match Superfamily | Length | Sequence Id | Overlap | RMSD | SIMAX |
|---|---|---|---|---|---|---|---|---|---|
 |
2r5sA01 | 80.56 | 1.25.40.10 | 82 | 8 | 87 | 3.42 | 3.90 |
[1]
Displaying entries 1 to 1 (page 1 of 1)
Domain ATOM Sequence
>pdb|3beeA00 NAVTATQLAAKATTLYYLHKQATDEVSLLLEQALQLEPYNEAALSLIANDHFISFRFQEAIDTWVLLLDSNDPNLDRVTI IESINKAKKL
Domain History Events (44)
Domain assignment manual match h by cuff on 06 Feb 2009 13:51
homology match
Homcheck allotment by cuff on 06 Feb 2009 13:49
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by cuff on 06 Feb 2009 13:49
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 28 Oct 2008 19:26
Domain "3beeA00" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 28 Oct 2008 19:26
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3beeA00
Flow stage update by auto on 28 Oct 2008 19:00
Retrieved PRC_PFAMCATH results for job ID SID7291284159815915 and results inserted.
Domain scan prc pfamcath by auto on 28 Oct 2008 18:59
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 115 results for 3beeA00
Update comment by auto on 26 Oct 2008 15:02
PRC_PFAMCATH job SID7291284159815915 is not yet finished.
Prc pfamcath submit by auto on 26 Oct 2008 14:58
The entry "3beeA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 26 Oct 2008 14:58
The entry "3beeA00" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 26 Oct 2008 14:52
Retrieved SSAP results for job ID SID5376045454945856 and results inserted.
Domain scan ssap cath by auto on 26 Oct 2008 14:47
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 3594 results for 3beeA00
Update comment by auto on 23 Oct 2008 18:43
SSAP job SID5376045454945856 is not yet finished.
Ssap cath submit by auto on 23 Oct 2008 18:24
The entry "3beeA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 23 Oct 2008 18:24
The entry "3beeA00" has been submitted to the SSAP webservice.
Flow stage update by auto on 23 Oct 2008 18:11
Retrieved PRC results for job ID SID0313489097281272 and inserted them into the database.
Domain scan prc cath by auto on 23 Oct 2008 18:10
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 29 results for 3beeA00
Update comment by auto on 23 Oct 2008 12:26
PRC job SID0313489097281272 is not yet finished.
Prc cath submit by auto on 23 Oct 2008 12:19
The entry "3beeA00" has been submitted to the PRC webservice.
Flow stage update by auto on 23 Oct 2008 12:19
The entry "3beeA00" has been submitted to the PRC webservice.
Flow stage update by auto on 23 Oct 2008 12:08
Retrieved HMM(SAM) results for job ID SID3926475971400232 and inserted them into the database.
Domain scan sam cath by auto on 23 Oct 2008 12:08
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 3beeA00
Update comment by auto on 22 Oct 2008 23:51
HMM(SAM) job SID3926475971400232 is not yet finished.
Sam cath submit by auto on 22 Oct 2008 23:46
The entry "3beeA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 22 Oct 2008 23:46
The entry "3beeA00" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 22 Oct 2008 23:31
Retrieved "3beeA00" CATHEDRAL results for job ID SID4520881105518074 and inserted them into the database.
Domain scan cathedral cath by auto on 22 Oct 2008 23:31
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 167 results for 3beeA00
Update comment by auto on 22 Oct 2008 14:43
"3beeA00" CATHEDRAL job SID4520881105518074 is not yet finished.
Cathedral cath submit by auto on 22 Oct 2008 14:36
The entry "3beeA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 22 Oct 2008 14:36
The entry "3beeA00" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 22 Oct 2008 14:25
ScanList with 12259 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3beeA00.scanlist" for "3beeA00"
Write scan list by auto on 22 Oct 2008 14:24
Writing ScanList containing 12259 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3beeA00.scanlist" for domain "3beeA00"
Update comment by auto on 22 Oct 2008 11:51
Waiting for 14 new domains (example : 3dgvA01) to be processed so that they can be scanned against too.
Update comment by auto on 22 Oct 2008 09:11
Waiting for 42 new domains (example : 3cb5B01) to be processed so that they can be scanned against too.
Update comment by auto on 22 Oct 2008 06:03
Waiting for 73 new domains (example : 3bjeA01) to be processed so that they can be scanned against too.
Update comment by auto on 22 Oct 2008 01:58
Waiting for 121 new domains (example : 3bgaA05) to be processed so that they can be scanned against too.
Update comment by auto on 21 Oct 2008 20:35
Waiting for 174 new domains (example : 3beeB00) to be processed so that they can be scanned against too.
Flow stage update by auto on 21 Oct 2008 20:34
No satisfactory AssignClose result found.
Flow stage update by auto on 21 Oct 2008 20:10
No in_process hits for Domain "3beeA00" ready to be processed
Flow stage update by auto on 21 Oct 2008 20:10
NW result present for Domain "3beeA00"
Flow stage update by auto on 21 Oct 2008 08:34
All required files are present for Domain "3beeA00"
Flow stage update by auto on 20 Oct 2008 18:49
Beginning processing for Domain "3beeA00"
Insertion by cuff on 20 Oct 2008 16:52
nice chopping
