CATH Domain: 3beeA00 XML data for domain: 3beeA00

Molscript image for 3beeA00
3beeA00
PDB coordinates for domain 3beeA00

PDB 3bee, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.25 Alpha Horseshoe
1.25.40 Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat
1.25.40.10 Gene3D
1.25.40.10.17
1.25.40.10.17.1
1.25.40.10.17.1.1
1.25.40.10.17.1.1.1
1.25.40.10.17.1.1.1.1

Segment boundaries for domain 3beeA00

Chopping figure for domain 3beeA00
DomainStart PDB ResidueStop PDB Residue
3beeA00 144 234

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.25.40.10.17.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2r5sA01 80.56 Vibrio parahaemolyticusPutative uncharacterized protein VP0806Putative thioredoxin 1.25.40.10 82 8 87 3.42 3.90
Displaying entries 1 to 1 (page 1 of 1)


Domain ATOM Sequence

>pdb|3beeA00
NAVTATQLAAKATTLYYLHKQATDEVSLLLEQALQLEPYNEAALSLIANDHFISFRFQEAIDTWVLLLDSNDPNLDRVTI
IESINKAKKL    

Domain COMBS Sequence

>pdb|3beeA00
SNAVTATQLAAKATTLYYLHKQAXTDEVSLLLEQALQLEPYNEAALSLIANDHFISFRFQEAIDTWVLLLDSNDPNLDRV
TIIESINKAKKLX    

Domain History Events (44)

Domain assigned by cuff on 06 Feb 2009 13:52

same superfamily

Domain assignment manual match h by cuff on 06 Feb 2009 13:51

homology match

Homcheck allotment by cuff on 06 Feb 2009 13:49

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 06 Feb 2009 13:49

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 28 Oct 2008 19:26

Domain "3beeA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 28 Oct 2008 19:26

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3beeA00

Flow stage update by auto on 28 Oct 2008 19:00

Retrieved PRC_PFAMCATH results for job ID SID7291284159815915 and results inserted.

Domain scan prc pfamcath by auto on 28 Oct 2008 18:59

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 115 results for 3beeA00

Update comment by auto on 26 Oct 2008 15:02

PRC_PFAMCATH job SID7291284159815915 is not yet finished.

Prc pfamcath submit by auto on 26 Oct 2008 14:58

The entry "3beeA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 26 Oct 2008 14:58

The entry "3beeA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 26 Oct 2008 14:52

Retrieved SSAP results for job ID SID5376045454945856 and results inserted.

Domain scan ssap cath by auto on 26 Oct 2008 14:47

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 3594 results for 3beeA00

Update comment by auto on 23 Oct 2008 18:43

SSAP job SID5376045454945856 is not yet finished.

Ssap cath submit by auto on 23 Oct 2008 18:24

The entry "3beeA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Oct 2008 18:24

The entry "3beeA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Oct 2008 18:11

Retrieved PRC results for job ID SID0313489097281272 and inserted them into the database.

Domain scan prc cath by auto on 23 Oct 2008 18:10

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 29 results for 3beeA00

Update comment by auto on 23 Oct 2008 12:26

PRC job SID0313489097281272 is not yet finished.

Prc cath submit by auto on 23 Oct 2008 12:19

The entry "3beeA00" has been submitted to the PRC webservice.

Flow stage update by auto on 23 Oct 2008 12:19

The entry "3beeA00" has been submitted to the PRC webservice.

Flow stage update by auto on 23 Oct 2008 12:08

Retrieved HMM(SAM) results for job ID SID3926475971400232 and inserted them into the database.

Domain scan sam cath by auto on 23 Oct 2008 12:08

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 3beeA00

Update comment by auto on 22 Oct 2008 23:51

HMM(SAM) job SID3926475971400232 is not yet finished.

Sam cath submit by auto on 22 Oct 2008 23:46

The entry "3beeA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Oct 2008 23:46

The entry "3beeA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Oct 2008 23:31

Retrieved "3beeA00" CATHEDRAL results for job ID SID4520881105518074 and inserted them into the database.

Domain scan cathedral cath by auto on 22 Oct 2008 23:31

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 167 results for 3beeA00

Update comment by auto on 22 Oct 2008 14:43

"3beeA00" CATHEDRAL job SID4520881105518074 is not yet finished.

Cathedral cath submit by auto on 22 Oct 2008 14:36

The entry "3beeA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Oct 2008 14:36

The entry "3beeA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Oct 2008 14:25

ScanList with 12259 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3beeA00.scanlist" for "3beeA00"

Write scan list by auto on 22 Oct 2008 14:24

Writing ScanList containing 12259 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3beeA00.scanlist" for domain "3beeA00"

Update comment by auto on 22 Oct 2008 11:51

Waiting for 14 new domains (example : 3dgvA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Oct 2008 09:11

Waiting for 42 new domains (example : 3cb5B01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Oct 2008 06:03

Waiting for 73 new domains (example : 3bjeA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Oct 2008 01:58

Waiting for 121 new domains (example : 3bgaA05) to be processed so that they can be scanned against too.

Update comment by auto on 21 Oct 2008 20:35

Waiting for 174 new domains (example : 3beeB00) to be processed so that they can be scanned against too.

Flow stage update by auto on 21 Oct 2008 20:34

No satisfactory AssignClose result found.

Flow stage update by auto on 21 Oct 2008 20:10

No in_process hits for Domain "3beeA00" ready to be processed

Flow stage update by auto on 21 Oct 2008 20:10

NW result present for Domain "3beeA00"

Flow stage update by auto on 21 Oct 2008 08:34

All required files are present for Domain "3beeA00"

Flow stage update by auto on 20 Oct 2008 18:49

Beginning processing for Domain "3beeA00"

Insertion by cuff on 20 Oct 2008 16:52

nice chopping