CATH Domain: 3be7A01 XML data for domain: 3be7A01

Molscript image for 3be7A01
3be7A01
PDB coordinates for domain 3be7A01

PDB 3be7, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.30 Roll
2.30.40 Urease, subunit C; domain 1
2.30.40.10 Urease, subunit C, domain 1 Gene3D
2.30.40.10.17
2.30.40.10.17.1
2.30.40.10.17.1.1
2.30.40.10.17.1.1.1
2.30.40.10.17.1.1.1.1

[top]
Segment boundaries for domain 3be7A01

Chopping figure for domain 3be7A01
DomainStart PDB ResidueStop PDB Residue
3be7A01 3 58
3be7A01 359 400
3be7A02 59 358

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 2.30.40.10.17.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2qs8A01 90.58 2.30.40.10 99 27 92 1.72 1.85
3feqA01 88.76 2.30.40.10 105 26 88 1.94 2.19
1gkrA01 85.25 L-hydantoinaseArthrobacter aurescens 2.30.40.10 87 20 82 2.41 2.94
2oodA01 77.73 Bradyrhizobium japonicumGuanine deaminase [EC:3.5.4.3]Purine metabolismBlr3880 proteinMetabolic pathways 2.30.40.10 135 18 67 2.51 3.72
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3be7A01
SEDFLIKSKGYLDIQTGEIIKADLLIRNGKIAEIGKINTKDATVISIPDLILIPGLGQIKEGFDADIVGVIENPLANIRT
LEEVAFVMKEGKVYKREG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3be7A01
MSLTSEDFLIKSKGYLDIQTGEIIKADLLIRNGKIAEIGKINTKDATVISIPDLILIPGLGQIKEGFDADIVGVIENPLA
NIRTLEEVAFVMKEGKVYKREGHHHHHH
BLAST against CATH

[top]
Domain History Events (20)

Domain assigned by auto on 03 Mar 2009 22:42

Assigning to "2.30.40.10" based on similarity with "3be7C01"

Flow stage update by auto on 03 Mar 2009 22:40

No in_process hits for Domain "3be7A01" ready to be processed

Update comment by auto on 03 Mar 2009 22:37

Domain "3be7A01" hits Domain "3be7E01" (100% over 100%) which is currently in process

Update comment by auto on 03 Mar 2009 22:33

Domain "3be7A01" hits Domain "3be7B01" (100% over 100%) which is currently in process

Update comment by auto on 03 Mar 2009 22:20

Domain "3be7A01" hits Domain "3be7F01" (100% over 100%) which is currently in process

Update comment by auto on 03 Mar 2009 22:16

Domain "3be7A01" hits Domain "3be7D01" (100% over 100%) which is currently in process

Update comment by auto on 03 Mar 2009 22:12

Domain "3be7A01" hits Domain "2r8cB01" (39.8148148148148% over 87.5%) which is currently in process

Update comment by auto on 03 Mar 2009 22:08

Domain "3be7A01" hits Domain "2r8cE01" (39.8148148148148% over 87.5%) which is currently in process

Update comment by auto on 03 Mar 2009 22:03

Domain "3be7A01" hits Domain "2r8cH01" (39.8148148148148% over 87.5%) which is currently in process

Update comment by auto on 03 Mar 2009 21:58

Domain "3be7A01" hits Domain "2r8cD01" (39.8148148148148% over 87.5%) which is currently in process

Update comment by auto on 03 Mar 2009 21:52

Domain "3be7A01" hits Domain "2r8cF01" (39.8148148148148% over 87.5%) which is currently in process

Update comment by auto on 03 Mar 2009 21:45

Domain "3be7A01" hits Domain "2r8cA01" (39.8148148148148% over 87.5%) which is currently in process

Update comment by auto on 03 Mar 2009 21:28

Domain "3be7A01" hits Domain "2r8cG01" (39.8148148148148% over 87.5%) which is currently in process

Update comment by auto on 03 Mar 2009 21:00

Domain "3be7A01" hits Domain "2r8cC01" (39.8148148148148% over 87.5%) which is currently in process

Update comment by auto on 15 Sep 2008 05:24

Domain "3be7A01" hits Domain "3be7C01" (100% over 100%) which is currently in process

Flow stage update by auto on 15 Sep 2008 05:21

Domain "3be7A01" hits Domain "3be7C01" (100% over 100%) which is currently in process

Flow stage update by auto on 15 Sep 2008 05:21

NW result present for Domain "3be7A01"

Flow stage update by auto on 11 Sep 2008 11:06

All required files are present for Domain "3be7A01"

Flow stage update by auto on 10 Sep 2008 17:44

Beginning processing for Domain "3be7A01"

Insertion by auto on 10 Sep 2008 14:36

Final ChopClose added based on similarity with "3be7B"