CATH Domain: 3bbyA02 XML data for domain: 3bbyA02

Molscript image for 3bbyA02
3bbyA02
PDB coordinates for domain 3bbyA02

PDB 3bby, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.1050 Glutathione S-transferase Yfyf (Class Pi); Chain A, domain 2
1.20.1050.10 Gene3D
1.20.1050.10.8
1.20.1050.10.8.1
1.20.1050.10.8.1.1
1.20.1050.10.8.1.1.1
1.20.1050.10.8.1.1.1.1

[top]
Segment boundaries for domain 3bbyA02

Chopping figure for domain 3bbyA02
DomainStart PDB ResidueStop PDB Residue
3bbyA01 3 84
3bbyA02 95 211

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 1.20.1050.10.8.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1eemA02 79.30 CytoplasmEffect on homeostasis (e.g. metabolism or electrolyte homeostasis)Oxidative stress responseNucleusHomo sapiens 1.20.1050.10 115 8 86 3.48 4.04
1aw9A02 78.25 Glutathione transferase III(A)Zea mays 1.20.1050.10 121 10 86 3.92 4.52
1gnwA02 77.82 Glutathione transferase activityMicrosomePlasma membraneToxin catabolic processMetabolism of phenylpropanoids 1.20.1050.10 125 9 81 4.06 4.98
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3bbyA02
DLENRARARQIQAWLRSDLPIREERPTDVVFAGAKKAPLTAEGKASAEKLFAAEHLLVLGQPNLFGEWCIADTDLALINR
LVLHGDEVPERLVDYATFQWQRASVQRFIALSAK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3bbyA02
DLENRARARQIQAWLRSDLXPIREERPTDVVFAGAKKAPLTAEGKASAEKLFAXAEHLLVLGQPNLFGEWCIADTDLALX
INRLVLHGDEVPERLVDYATFQWQRASVQRFIALSAKQSG
BLAST against CATH

[top]
Domain History Events (45)

Domain assigned by cuff on 05 Mar 2009 15:04

same superfamily

Domain assignment manual match h by cuff on 05 Mar 2009 15:03

homology match

Homcheck allotment by cuff on 05 Feb 2009 17:31

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 05 Feb 2009 17:31

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 28 Nov 2008 00:51

Domain "3bbyA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 28 Nov 2008 00:51

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3bbyA02

Flow stage update by auto on 28 Nov 2008 00:17

Retrieved PRC_PFAMCATH results for job ID SID4904070133689728 and results inserted.

Domain scan prc pfamcath by auto on 28 Nov 2008 00:16

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 28 results for 3bbyA02

Flow stage update by auto on 28 Nov 2008 00:11

The entry "3bbyA02" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 28 Nov 2008 00:10

The entry "3bbyA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 27 Nov 2008 23:36

Retrieved SSAP results for job ID SID9444624119122336 and results inserted.

Domain scan ssap cath by auto on 27 Nov 2008 23:30

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1751 results for 3bbyA02

Update comment by auto on 27 Nov 2008 07:21

SSAP job SID9444624119122336 is not yet finished.

Flow stage update by auto on 27 Nov 2008 07:13

The entry "3bbyA02" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 27 Nov 2008 07:13

The entry "3bbyA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 27 Nov 2008 06:40

Retrieved PRC results for job ID SID9704761758465088 and inserted them into the database.

Domain scan prc cath by auto on 27 Nov 2008 06:40

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 16 results for 3bbyA02

Prc cath submit by auto on 27 Nov 2008 06:27

The entry "3bbyA02" has been submitted to the PRC webservice.

Flow stage update by auto on 27 Nov 2008 06:27

The entry "3bbyA02" has been submitted to the PRC webservice.

Flow stage update by auto on 27 Nov 2008 05:56

Retrieved HMM(SAM) results for job ID SID3354374240989152 and inserted them into the database.

Domain scan sam cath by auto on 27 Nov 2008 05:55

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 3bbyA02

Update comment by auto on 27 Nov 2008 03:36

HMM(SAM) job SID3354374240989152 is not yet finished.

Sam cath submit by auto on 27 Nov 2008 03:25

The entry "3bbyA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 27 Nov 2008 03:25

The entry "3bbyA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Nov 2008 23:38

Unable to retrieve "3bbyA02" HMM(SAM) results for job "SID9934259845290360"

Update comment by auto on 26 Nov 2008 20:36

HMM(SAM) job SID9934259845290360 is not yet finished.

Flow stage update by auto on 26 Nov 2008 20:27

The entry "3bbyA02" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 26 Nov 2008 20:27

The entry "3bbyA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Nov 2008 17:37

Unable to retrieve "3bbyA02" HMM(SAM) results for job "SID1583122235585920"

Update comment by auto on 26 Nov 2008 15:58

HMM(SAM) job SID1583122235585920 is not yet finished.

Sam cath submit by auto on 26 Nov 2008 15:51

The entry "3bbyA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Nov 2008 15:51

The entry "3bbyA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Nov 2008 15:14

Retrieved "3bbyA02" CATHEDRAL results for job ID SID0350600385722072 and inserted them into the database.

Domain scan cathedral cath by auto on 26 Nov 2008 15:13

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 250 results for 3bbyA02

Update comment by auto on 26 Nov 2008 11:45

"3bbyA02" CATHEDRAL job SID0350600385722072 is not yet finished.

Cathedral cath submit by auto on 26 Nov 2008 11:37

The entry "3bbyA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 26 Nov 2008 11:37

The entry "3bbyA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 26 Nov 2008 11:27

ScanList with 12333 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3bbyA02.scanlist" for "3bbyA02"

Write scan list by auto on 26 Nov 2008 11:27

Writing ScanList containing 12333 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3bbyA02.scanlist" for domain "3bbyA02"

Flow stage update by auto on 26 Nov 2008 11:22

No satisfactory AssignClose result found.

Flow stage update by auto on 26 Nov 2008 11:07

No in_process hits for Domain "3bbyA02" ready to be processed

Flow stage update by auto on 26 Nov 2008 11:07

NW result present for Domain "3bbyA02"

Flow stage update by auto on 20 Nov 2008 11:07

All required files are present for Domain "3bbyA02"

Flow stage update by auto on 19 Nov 2008 17:59

Beginning processing for Domain "3bbyA02"

Insertion by cuff on 19 Nov 2008 17:35

nice chopping