CATH Domain: 3bb9B00 XML data for domain: 3bb9B00

Molscript image for 3bb9B00
3bb9B00
PDB coordinates for domain 3bb9B00

PDB 3bb9, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.450 Nuclear Transport Factor 2; Chain: A,
3.10.450.50 Gene3D
3.10.450.50.20
3.10.450.50.20.1
3.10.450.50.20.1.1
3.10.450.50.20.1.1.1
3.10.450.50.20.1.1.1.1

[top]
Segment boundaries for domain 3bb9B00

Chopping figure for domain 3bb9B00
DomainStart PDB ResidueStop PDB Residue
3bb9B00 23 147

Structural Neighbourhood (9 entries)

There are 9 matching structural neighberhood comparisons for CATH ID 3.10.450.50.20.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 9 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2owpA00 84.49 Burkholderia xenovorans LB400Putative uncharacterized protein 3.10.450.50 124 11 90 3.34 3.70
2ux0B00 84.45 Calcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiensCalcium- and calmodulin-dependent protein kinase complex 3.10.450.50 136 16 87 3.58 4.09
3b7cA00 83.65 Shewanella oneidensisPutative uncharacterized protein 3.10.450.50 115 18 91 3.22 3.51
1m98A02 82.48 Arthrospira maximaOrange carotenoid-binding protein 3.10.450.50 128 10 85 2.52 2.96
1of5B00 81.87 Nuclear poreNuclear RNA export factor complexMRNA transport regulator MTR2Ribosomal large subunit export from nucleusSaccharomyces cerevisiae 3.10.450.50 128 9 86 3.28 3.78
3cu3A00 78.09 Domain of unknown function with a cystatin-like foldNostoc punctiforme PCC 73102 3.10.450.50 160 14 68 3.32 4.83
2qguA01 77.30 Probable signal peptide proteinRalstonia solanacearum 3.10.450.50 101 8 62 2.23 3.57
1vqqB01 76.11 Staphylococcus aureusPenicillin binding protein 2' 3.10.450.100 103 12 79 3.79 4.79
1jkgB00 75.87 Nuclear RNA export factor 1Homo sapiensProtein binding 3.10.450.50 180 5 64 2.73 4.24
[1]
Displaying entries 1 to 9 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3bb9B00
AFIGVDSAAGNVVKQFHAALQGNEAIVRQSLAANVQIYEGGKVERSLTEYANHHLADAYLKGLTITPKEHQITITGDIAI
STSISHAQGEYKGKSIDSTETLVLIKQADGRWKITHVHWS
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3bb9B00
AFIGVDSAAGNVVKQFHAALQXGNEAIVRQSLAANVQIYEGGKVERSLTEYANHHXLADXAYLKGLTITPKEHQITITGD
IAISTSISHAQGEYKGKSIDSXTXETLVLIKQADGRWKITHVHWS
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 18 Feb 2009 18:42

Assigning to "3.10.450.50" based on similarity with "3bb9A00"

Flow stage update by auto on 18 Feb 2009 18:15

No in_process hits for Domain "3bb9B00" ready to be processed

Update comment by auto on 21 Oct 2008 20:12

Domain "3bb9B00" hits Domain "3bb9A00" (96% over 100%) which is currently in process

Flow stage update by auto on 21 Oct 2008 20:10

Domain "3bb9B00" hits Domain "3bb9A00" (96% over 100%) which is currently in process

Flow stage update by auto on 21 Oct 2008 20:10

NW result present for Domain "3bb9B00"

Flow stage update by auto on 21 Oct 2008 08:34

All required files are present for Domain "3bb9B00"

Flow stage update by auto on 20 Oct 2008 18:49

Beginning processing for Domain "3bb9B00"

Insertion by auto on 20 Oct 2008 17:10

Final ChopClose added based on similarity with "3bb9A"