CATH Domain: 3b8xA02 XML data for domain: 3b8xA02

Molscript image for 3b8xA02
3b8xA02
PDB coordinates for domain 3b8xA02

PDB 3b8x, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.90 Alpha-Beta Complex
3.90.1150 Aspartate Aminotransferase, domain 1
3.90.1150.10 Aspartate Aminotransferase, domain 1 Gene3D
3.90.1150.10.15
3.90.1150.10.15.1
3.90.1150.10.15.1.1
3.90.1150.10.15.1.1.1
3.90.1150.10.15.1.1.1.1

[top]
Segment boundaries for domain 3b8xA02

Chopping figure for domain 3b8xA02
DomainStart PDB ResidueStop PDB Residue
3b8xA01 3 264
3b8xA02 265 388

Structural Neighbourhood (19 entries)

There are 19 matching structural neighberhood comparisons for CATH ID 3.90.1150.10.15.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 19 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1mdoA02 85.35 Amino sugar and nucleotide sugar metabolismUDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferaseTwo-component systemSalmonella enterica subsp. enterica serovar TyphimuriumUDP-4-amino-4-deoxy-L-arabinose-oxoglutarate aminotransferase [EC:2.6.1.-] 3.90.1150.10 123 13 92 2.62 2.83
1b9hA02 82.93 Amycolatopsis mediterraneiRifK 3.90.1150.10 139 13 87 2.76 3.14
1m32A01 80.45 2-aminoethylphosphonate--pyruvate transaminaseSalmonella enterica subsp. enterica serovar Typhimurium2-aminoethylphosphonate-pyruvate transaminase [EC:2.6.1.37]Phosphonate and phosphinate metabolismMetabolic pathways 3.90.1150.10 110 10 77 2.89 3.73
1p3wA01 79.58 Thiamine metabolismCysteine desulfurase activitySelenocysteine lyase activityCysteine desulfuraseIron-sulfur cluster assembly 3.90.1150.10 121 9 86 3.82 4.43
1eluA01 79.20 Synechocystis sp. PCC 6714L-cysteine/cystine lyase C-DES 3.90.1150.10 115 14 75 2.38 3.17
3ffhA01 79.16 Tyrosine metabolismListeria innocuaHistidinol-phosphate aminotransferase [EC:2.6.1.9]Histidine metabolismPhenylalanine metabolism 3.90.1150.10 131 4 67 2.30 3.42
1eg5B01 79.16 Thermotoga maritimaThiamine metabolismCysteine desulfurase [EC:2.8.1.7]Aminotransferase, class V 3.90.1150.10 106 10 76 3.20 4.18
1d2fB01 79.10 Nitrogen metabolismSelenoamino acid metabolismSulfur metabolismMetabolic pathwaysCysteine and methionine metabolism 3.90.1150.10 124 9 77 3.07 3.97
1iugA01 78.65 Thermus thermophilusAspartate aminotransferase 3.90.1150.10 111 11 75 2.79 3.68
1fc4A02 77.38 Glycine, serine and threonine metabolismLigase activityMetal ion binding2-amino-3-ketobutyrate coenzyme A ligaseGlycine C-acetyltransferase [EC:2.3.1.29] 3.90.1150.10 133 8 69 3.42 4.94
1jg8A02 77.24 Thermotoga maritimaThreonine aldolase [EC:4.1.2.5]Glycine, serine and threonine metabolismMetabolic pathwaysL-allo-threonine aldolase 3.90.1150.10 96 11 70 2.47 3.48
3dydA01 76.45 Tyrosine metabolismL-tyrosine:2-oxoglutarate aminotransferase activityMetabolic pathwaysPhenylalanine metabolismUbiquinone and other terpenoid-quinone biosynthesis 3.90.1150.10 137 11 68 2.61 3.80
5bj4A01 75.86 Tyrosine metabolismArginine and proline metabolismAspartate aminotransferase [EC:2.6.1.1]Metabolic pathwaysPhenylalanine metabolism 3.90.1150.10 146 8 63 2.75 4.36
1djuB01 75.51 Tyrosine metabolismArginine and proline metabolismAspartate aminotransferase [EC:2.6.1.1]Pyrococcus horikoshiiMetabolic pathways 3.90.1150.10 143 7 65 2.75 4.18
1uu2B01 75.44 Thermotoga maritimaTyrosine metabolismHistidinol-phosphate aminotransferase [EC:2.6.1.9]Histidine metabolismMetabolic pathways 3.90.1150.10 117 9 66 2.99 4.47
1xi9B01 75.21 Pyrococcus furiosusAminotransferase [EC:2.6.1.-]Alanine aminotransferase 3.90.1150.10 144 5 66 3.01 4.51
3ftbA01 74.82 Tyrosine metabolismHistidinol-phosphate aminotransferase [EC:2.6.1.9]Histidine metabolismMetabolic pathwaysPhenylalanine metabolism 3.90.1150.10 112 9 71 2.95 4.11
1c7nA01 74.50 Treponema denticolaHemolysin 3.90.1150.10 164 11 57 2.72 4.70
2qmaA02 74.13 Diaminobutyrate-2-oxoglutarate transaminase [EC:2.6.1.76]Vibrio parahaemolyticusGlycine, serine and threonine metabolismDiaminobutyrate-pyruvate transaminase & L-2,4-diaminobutyrate decarboxylaseMetabolic pathways 3.90.1150.10 122 7 75 3.34 4.45
[1]
Displaying entries 1 to 19 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3b8xA02
KLPRFISVRRKNAEYFLDKFKDHPYLDVQQETGESSWFGFSFIIKKDSGVIRKQLVENLNSAGIECRPIVTGNFLKNTDV
LKYFDYTVHNNVDNAEYLDKNGLFVGNHQIELFDEIDYLREVLK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3b8xA02
KLPRFISVRRKNAEYFLDKFKDHPYLDVQQETGESSWFGFSFIIKKDSGVIRKQLVENLNSAGIECRPIVTGNFLKNTDV
LKYFDYTVHNNVDNAEYLDKNGLFVGNHQIELFDEIDYLREVLK
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 18 Mar 2009 15:44

Assigning to "3.90.1150.10" based on similarity with "3b8xB02"

Flow stage update by auto on 18 Mar 2009 15:42

No in_process hits for Domain "3b8xA02" ready to be processed

Update comment by auto on 18 Mar 2009 15:40

Domain "3b8xA02" hits Domain "3b8xB02" (100% over 100%) which is currently in process

Update comment by auto on 18 Mar 2009 15:37

Domain "3b8xA02" hits Domain "2r0tB02" (100% over 100%) which is currently in process

Update comment by auto on 10 Dec 2008 14:21

Domain "3b8xA02" hits Domain "2r0tA02" (100% over 100%) which is currently in process

Flow stage update by auto on 10 Dec 2008 14:17

Domain "3b8xA02" hits Domain "2r0tA02" (100% over 100%) which is currently in process

Flow stage update by auto on 10 Dec 2008 14:17

NW result present for Domain "3b8xA02"

Flow stage update by auto on 10 Dec 2008 14:16

All required files are present for Domain "3b8xA02"

Flow stage update by auto on 10 Dec 2008 14:14

Beginning processing for Domain "3b8xA02"

Insertion by auto on 05 Dec 2008 17:48

Final ChopClose added based on similarity with "3b8xB"