CATH Domain: 3b8lA01 XML data for domain: 3b8lA01

Molscript image for 3b8lA01
3b8lA01
PDB coordinates for domain 3b8lA01

PDB 3b8l, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.450 Nuclear Transport Factor 2; Chain: A,
3.10.450.50 Gene3D
3.10.450.50.10
3.10.450.50.10.1
3.10.450.50.10.1.1
3.10.450.50.10.1.1.1
3.10.450.50.10.1.1.1.1

Segment boundaries for domain 3b8lA01

Chopping figure for domain 3b8lA01
DomainStart PDB ResidueStop PDB Residue
3b8lA01 4 144

Structural Neighbourhood (16 entries)

There are 16 matching structural neighberhood comparisons for CATH ID 3.10.450.50.10.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 16 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3cnxA00 86.41 Streptomyces avermitilisPutative uncharacterized protein 3.10.450.50 135 16 88 1.99 2.26
2rgqB00 85.98 3.10.450.50 124 16 89 3.00 3.35
1ohpA00 84.39 Comamonas testosteroniSteroid Delta-isomerase 3.10.450.50 125 16 87 3.73 4.27
2ux0B00 83.88 Calcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiensCalcium- and calmodulin-dependent protein kinase complex 3.10.450.50 136 12 91 3.03 3.32
1tuhA00 83.02 Uncultured bacteriumPutative uncharacterized protein 3.10.450.50 131 10 90 3.22 3.56
1gy6A00 82.57 Nuclear transport factor 2Nuclear poreHomo sapiensProtein bindingCytosol 3.10.450.50 125 11 90 3.50 3.87
3b7cA00 82.18 Shewanella oneidensisPutative uncharacterized protein 3.10.450.50 115 12 82 2.38 2.89
3blzA00 82.00 Shewanella baltica OS155Putative uncharacterized protein 3.10.450.50 123 15 82 2.60 3.16
1jkgA00 81.84 CytoplasmNuclear poreHomo sapiensNTF2-related export protein 1 3.10.450.50 139 10 84 2.64 3.11
3bb9B00 81.69 Putative orphan proteinShewanella frigidimarina NCIMB 400 3.10.450.50 120 9 85 3.58 4.17
3dm8A00 81.04 Rhodopseudomonas palustrisPutative uncharacterized protein 3.10.450.50 131 9 87 3.75 4.29
2r4iA00 80.96 Cytophaga hutchinsonii ATCC 33406Putative uncharacterized protein 3.10.450.50 113 12 82 2.84 3.45
1of5B00 80.04 Nuclear poreNuclear RNA export factor complexMRNA transport regulator MTR2Ribosomal large subunit export from nucleusSaccharomyces cerevisiae 3.10.450.50 128 7 88 3.63 4.08
2bmoB00 78.96 Oxygenase-beta NBDOComamonas sp. JS765Protein binding 3.10.450.50 194 9 68 2.88 4.20
2owpA00 78.48 Burkholderia xenovorans LB400Putative uncharacterized protein 3.10.450.50 124 16 85 3.51 4.12
1q42A00 77.25 MRNA transport regulator MTR2Candida albicans 3.10.450.50 159 8 79 3.46 4.37
Displaying entries 1 to 16 (page 1 of 1)


Domain ATOM Sequence

>pdb|3b8lA01
PIEDRLAIQDLIAYAHAVDTVSDIDAVLDVFTEDAVFDLSGIGLTPQVGHAGIREFFTNVFANSHHAHYLTNFAVTGYEG
DTASRAYVIGGVGKDGRAVTVNGRYFFEVRRTEKGWKATRYTDFLPLSGTLDNAK    

Domain COMBS Sequence

>pdb|3b8lA01
PIEDRLAIQDLXIAYAHAVDTVSDIDAVLDVFTEDAVFDLSGIGLTPQVGHAGIREFFTNVFANXSHHAHYLTNFAVTGY
EGDTASXRAYVIGXGVGKDGRAVTVNGRYFFEVRRTEKGWKATRYTXDFLXPLSGTLDNAK    

Domain History Events (45)

Domain assigned by cuff on 05 Feb 2009 16:11

homology match

Domain assignment manual match h by cuff on 05 Feb 2009 16:10

homology match

Homcheck allotment by cuff on 05 Feb 2009 16:09

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 05 Feb 2009 16:09

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 28 Oct 2008 19:17

Domain "3b8lA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 28 Oct 2008 19:17

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3b8lA01

Flow stage update by auto on 28 Oct 2008 18:48

Retrieved PRC_PFAMCATH results for job ID SID6211319053672509 and results inserted.

Domain scan prc pfamcath by auto on 28 Oct 2008 18:48

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 57 results for 3b8lA01

Update comment by auto on 25 Oct 2008 14:52

PRC_PFAMCATH job SID6211319053672509 is not yet finished.

Prc pfamcath submit by auto on 25 Oct 2008 14:50

The entry "3b8lA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 25 Oct 2008 14:50

The entry "3b8lA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 25 Oct 2008 14:43

Retrieved SSAP results for job ID SID9305999925610024 and results inserted.

Domain scan ssap cath by auto on 25 Oct 2008 14:40

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1090 results for 3b8lA01

Update comment by auto on 23 Oct 2008 18:41

SSAP job SID9305999925610024 is not yet finished.

Ssap cath submit by auto on 23 Oct 2008 18:22

The entry "3b8lA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Oct 2008 18:22

The entry "3b8lA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Oct 2008 17:59

Retrieved PRC results for job ID SID1925666120748960 and inserted them into the database.

Domain scan prc cath by auto on 23 Oct 2008 17:59

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 22 results for 3b8lA01

Update comment by auto on 23 Oct 2008 10:10

PRC job SID1925666120748960 is not yet finished.

Prc cath submit by auto on 23 Oct 2008 10:07

The entry "3b8lA01" has been submitted to the PRC webservice.

Flow stage update by auto on 23 Oct 2008 10:07

The entry "3b8lA01" has been submitted to the PRC webservice.

Flow stage update by auto on 23 Oct 2008 09:56

Retrieved HMM(SAM) results for job ID SID5650363734879984 and inserted them into the database.

Domain scan sam cath by auto on 23 Oct 2008 09:55

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 11 results for 3b8lA01

Update comment by auto on 22 Oct 2008 20:53

HMM(SAM) job SID5650363734879984 is not yet finished.

Sam cath submit by auto on 22 Oct 2008 20:51

The entry "3b8lA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Oct 2008 20:51

The entry "3b8lA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Oct 2008 20:42

Retrieved "3b8lA01" CATHEDRAL results for job ID SID8309917901540528 and inserted them into the database.

Domain scan cathedral cath by auto on 22 Oct 2008 20:42

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 49 results for 3b8lA01

Update comment by auto on 22 Oct 2008 14:41

"3b8lA01" CATHEDRAL job SID8309917901540528 is not yet finished.

Flow stage update by auto on 22 Oct 2008 14:34

The entry "3b8lA01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 22 Oct 2008 14:34

The entry "3b8lA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Oct 2008 14:21

ScanList with 12259 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3b8lA01.scanlist" for "3b8lA01"

Write scan list by auto on 22 Oct 2008 14:21

Writing ScanList containing 12259 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3b8lA01.scanlist" for domain "3b8lA01"

Update comment by auto on 22 Oct 2008 11:51

Waiting for 14 new domains (example : 3dgvA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Oct 2008 09:11

Waiting for 42 new domains (example : 3cb5B01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Oct 2008 06:02

Waiting for 73 new domains (example : 3bjeA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Oct 2008 01:58

Waiting for 121 new domains (example : 3bgaA05) to be processed so that they can be scanned against too.

Update comment by auto on 21 Oct 2008 20:35

Waiting for 174 new domains (example : 3beeB00) to be processed so that they can be scanned against too.

Update comment by auto on 21 Oct 2008 18:34

Waiting for 225 new domains (example : 3b8sB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 21 Oct 2008 17:26

No satisfactory AssignClose result found.

Flow stage update by auto on 21 Oct 2008 17:08

No in_process hits for Domain "3b8lA01" ready to be processed

Flow stage update by auto on 21 Oct 2008 17:08

NW result present for Domain "3b8lA01"

Flow stage update by auto on 21 Oct 2008 08:34

All required files are present for Domain "3b8lA01"

Flow stage update by auto on 20 Oct 2008 18:49

Beginning processing for Domain "3b8lA01"

Insertion by cuff on 20 Oct 2008 16:24

nice chopping