Domain assigned by cuff on 05 Feb 2009 16:11
homology match
| CATH Code | Level Description | Links |
|---|---|---|
3
| Alpha Beta | |
3.10
| Roll | |
3.10.450
| Nuclear Transport Factor 2; Chain: A, | |
3.10.450.50
| Gene3D | |
3.10.450.50.10
| ||
3.10.450.50.10.1
| ||
3.10.450.50.10.1.1
| ||
3.10.450.50.10.1.1.1
| ||
3.10.450.50.10.1.1.1.1
|
There are 16 matching structural neighberhood comparisons for CATH ID 3.10.450.50.10.1.1.1.1 (SIMAX score < 5)
>pdb|3b8lA01 PIEDRLAIQDLIAYAHAVDTVSDIDAVLDVFTEDAVFDLSGIGLTPQVGHAGIREFFTNVFANSHHAHYLTNFAVTGYEG DTASRAYVIGGVGKDGRAVTVNGRYFFEVRRTEKGWKATRYTDFLPLSGTLDNAK
homology match
homology match
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Domain "3b8lA01" SCOP scan with no results - no SCOP mapping
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3b8lA01
Retrieved PRC_PFAMCATH results for job ID SID6211319053672509 and results inserted.
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 57 results for 3b8lA01
PRC_PFAMCATH job SID6211319053672509 is not yet finished.
The entry "3b8lA01" has been submitted to the PRC_PFAMCATH webservice.
The entry "3b8lA01" has been submitted to the PRC_PFAMCATH webservice.
Retrieved SSAP results for job ID SID9305999925610024 and results inserted.
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1090 results for 3b8lA01
SSAP job SID9305999925610024 is not yet finished.
The entry "3b8lA01" has been submitted to the SSAP webservice.
The entry "3b8lA01" has been submitted to the SSAP webservice.
Retrieved PRC results for job ID SID1925666120748960 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 22 results for 3b8lA01
PRC job SID1925666120748960 is not yet finished.
The entry "3b8lA01" has been submitted to the PRC webservice.
The entry "3b8lA01" has been submitted to the PRC webservice.
Retrieved HMM(SAM) results for job ID SID5650363734879984 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 11 results for 3b8lA01
HMM(SAM) job SID5650363734879984 is not yet finished.
The entry "3b8lA01" has been submitted to the HMM (SAM) webservice.
The entry "3b8lA01" has been submitted to the HMM (SAM) webservice.
Retrieved "3b8lA01" CATHEDRAL results for job ID SID8309917901540528 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 49 results for 3b8lA01
"3b8lA01" CATHEDRAL job SID8309917901540528 is not yet finished.
The entry "3b8lA01" has been submitted to the CATHEDRAL webservice.
The entry "3b8lA01" has been submitted to the CATHEDRAL webservice.
ScanList with 12259 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3b8lA01.scanlist" for "3b8lA01"
Writing ScanList containing 12259 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3b8lA01.scanlist" for domain "3b8lA01"
Waiting for 14 new domains (example : 3dgvA01) to be processed so that they can be scanned against too.
Waiting for 42 new domains (example : 3cb5B01) to be processed so that they can be scanned against too.
Waiting for 73 new domains (example : 3bjeA01) to be processed so that they can be scanned against too.
Waiting for 121 new domains (example : 3bgaA05) to be processed so that they can be scanned against too.
Waiting for 174 new domains (example : 3beeB00) to be processed so that they can be scanned against too.
Waiting for 225 new domains (example : 3b8sB01) to be processed so that they can be scanned against too.
No satisfactory AssignClose result found.
No in_process hits for Domain "3b8lA01" ready to be processed
NW result present for Domain "3b8lA01"
All required files are present for Domain "3b8lA01"
Beginning processing for Domain "3b8lA01"
nice chopping