CATH Domain: 3b8fC00 XML data for domain: 3b8fC00

Molscript image for 3b8fC00
3b8fC00
PDB coordinates for domain 3b8fC00

PDB 3b8f, Chain C, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.140 Cytidine Deaminase; domain 2
3.40.140.10 Cytidine Deaminase, domain 2 Gene3D
3.40.140.10.4
3.40.140.10.4.1
3.40.140.10.4.1.1
3.40.140.10.4.1.1.1
3.40.140.10.4.1.1.1.1

[top]
Segment boundaries for domain 3b8fC00

Chopping figure for domain 3b8fC00
DomainStart PDB ResidueStop PDB Residue
3b8fC00 2 141

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.40.140.10.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1r5tB00 85.29 Cytidine deaminasePyrimidine metabolismIdentical protein bindingNucleusCytidine deaminase activity 3.40.140.10 139 15 89 3.45 3.86
3ijfX00 84.87 Pyrimidine metabolismMetabolic pathwaysCytidine deaminaseCytidine deaminase [EC:3.5.4.5]Mycobacterium tuberculosis 3.40.140.10 123 21 84 2.74 3.25
1cttA01 81.80 Pyrimidine metabolismMetabolic pathwaysCytidine deaminaseZinc ion bindingCytidine deaminase activity 3.40.140.10 151 12 82 3.64 4.40
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3b8fC00
NIEQQLYDVVKQLIEQRYPNDWGGAAAIRVEDGTIYTSVAPDVINASTELCMETGAILEAHKFQKKVTHSICLARENEHS
ELKVLSPCGVCQERLFYWGPEVQCAITNAKQDIIFKPLKELQPYHWTEAYHDEMVKEWST
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3b8fC00
LNIEQQLYDVVKQLIEQRYPNDWGGAAAIRVEDGTIYTSVAPDVINASTELCMETGAILEAHKFQKKVTHSICLARENEH
SELKVLSPCGVCQERLFYWGPEVQCAITNAKQDIIFKPLKELQPYHWTEAYHDEMVKEWSTR
BLAST against CATH

[top]
Domain History Events (10)

Domain assigned by auto on 18 Feb 2009 19:38

Assigning to "3.40.140.10" based on similarity with "3b8fA00"

Flow stage update by auto on 18 Feb 2009 19:15

No in_process hits for Domain "3b8fC00" ready to be processed

Update comment by auto on 18 Feb 2009 18:47

Domain "3b8fC00" hits Domain "3b8fB00" (100% over 100%) which is currently in process

Update comment by auto on 18 Feb 2009 18:15

Domain "3b8fC00" hits Domain "3b8fD00" (100% over 100%) which is currently in process

Update comment by auto on 21 Oct 2008 17:09

Domain "3b8fC00" hits Domain "3b8fA00" (100% over 100%) which is currently in process

Flow stage update by auto on 21 Oct 2008 17:08

Domain "3b8fC00" hits Domain "3b8fA00" (100% over 100%) which is currently in process

Flow stage update by auto on 21 Oct 2008 17:08

NW result present for Domain "3b8fC00"

Flow stage update by auto on 21 Oct 2008 08:34

All required files are present for Domain "3b8fC00"

Flow stage update by auto on 20 Oct 2008 18:49

Beginning processing for Domain "3b8fC00"

Insertion by auto on 20 Oct 2008 17:15

Final ChopClose added based on similarity with "3b8fA"