Domain assigned by cuff on 24 Mar 2009 15:09
same superfamily
CATH Domain: 3b8cA01
3b8cA01
PDB 3b8c, Chain A, Domain 1
Segment boundaries for domain 3b8cA01
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 3b8cA01 | 62 | 127 |
| 3b8cA01 | 239 | 323 |
| 3b8cA01 | 635 | 844 |
| 3b8cA02 | 128 | 222 |
| 3b8cA03 | 324 | 338 |
| 3b8cA03 | 487 | 634 |
| 3b8cA04 | 339 | 486 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|3b8cA01 LGFMWNPLSWVMEMAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAAALMAGVLTAIGNFCICSIA IGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMSRAIFQRMK NYTIYAVSITIRIVFGFMLIALIWEFDFSAFMVLIIAILNDGTIMTISKDRVKPSPTPDSWKLKEIFATGVVLGGYQAIM TVIFFWAAHKTDFFSDTFGVRSIRDNNHELMGAVYLQVSIISQALIFVTRSRSWSFVERPGALLMIAFLIAQLIATLIAV YANWEFAKIRGIGWGWAGVIWLYSIVTYFPLDVFKFAIRYI
Domain COMBS Sequence
>pdb|3b8cA01 LGFMWNPLSWVMEMAAIMAIALANGDGRPPDWQDFVGIICLLVINSTISFIEENNAGNAAAALMAGVLTAIGNFCICSIA IGMVIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMSRAIFQRMK NYTIYAVSITIRIVFGFMLIALIWEFDFSAFMVLIIAILNDGTIMTISKDRVKPSPTPDSWKLKEIFATGVVLGGYQAIM TVIFFWAAHKTDFFSDTFGVRSIRDNNHELMGAVYLQVSIISQALIFVTRSRSWSFVERPGALLMIAFLIAQLIATLIAV YANWEFAKIRGIGWGWAGVIWLYSIVTYFPLDVFKFAIRYI
Domain History Events (61)
Domain assignment manual match h by cuff on 24 Mar 2009 15:07
same superfamily
Homcheck allotment by cuff on 24 Mar 2009 15:00
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by cuff on 24 Mar 2009 15:00
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 19 Mar 2009 17:37
Domain "3b8cA01" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 19 Mar 2009 17:36
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3b8cA01
Flow stage update by auto on 19 Mar 2009 14:29
Retrieved PRC_PFAMCATH results for job ID SID4243282952076256 and results inserted.
Domain scan prc pfamcath by auto on 19 Mar 2009 14:28
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 113 results for 3b8cA01
Update comment by auto on 07 Mar 2009 09:41
PRC_PFAMCATH job SID4243282952076256 is not yet finished.
Flow stage update by auto on 07 Mar 2009 09:34
The entry "3b8cA01" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 07 Mar 2009 09:33
The entry "3b8cA01" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 07 Mar 2009 08:18
Retrieved SSAP results for job ID SID4112248449527764 and results inserted.
Domain scan ssap cath by auto on 07 Mar 2009 08:17
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2 results for 3b8cA01
Update comment by auto on 04 Mar 2009 09:12
SSAP job SID4112248449527764 is not yet finished.
Ssap cath submit by auto on 04 Mar 2009 08:52
The entry "3b8cA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 04 Mar 2009 08:52
The entry "3b8cA01" has been submitted to the SSAP webservice.
Flow stage update by auto on 04 Mar 2009 06:59
Retrieved PRC results for job ID SID0221033882821328 and inserted them into the database.
Domain scan prc cath by auto on 04 Mar 2009 06:58
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 23 results for 3b8cA01
Update comment by auto on 04 Mar 2009 01:50
PRC job SID0221033882821328 is not yet finished.
Prc cath submit by auto on 04 Mar 2009 01:43
The entry "3b8cA01" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Mar 2009 01:43
The entry "3b8cA01" has been submitted to the PRC webservice.
Flow stage update by auto on 04 Mar 2009 00:58
Retrieved HMM(SAM) results for job ID SID6443893984815680 and inserted them into the database.
Domain scan sam cath by auto on 04 Mar 2009 00:57
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 3b8cA01
Flow stage update by auto on 03 Mar 2009 23:33
The entry "3b8cA01" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 03 Mar 2009 23:33
The entry "3b8cA01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 19 Feb 2009 15:54
Unable to retrieve "3b8cA01" HMM(SAM) results for job "SID1391464134850702"
Update comment by auto on 19 Feb 2009 08:34
HMM(SAM) job SID1391464134850702 is not yet finished.
Flow stage update by auto on 19 Feb 2009 08:06
The entry "3b8cA01" has been submitted to the HMM (SAM) webservice.
Sam cath submit by auto on 19 Feb 2009 08:06
The entry "3b8cA01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 27 Jan 2009 12:17
Unable to retrieve "3b8cA01" HMM(SAM) results for job "SID0060692953493066"
Update comment by auto on 22 Jan 2009 17:45
HMM(SAM) job SID0060692953493066 is not yet finished.
Sam cath submit by auto on 22 Jan 2009 17:26
The entry "3b8cA01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 22 Jan 2009 17:26
The entry "3b8cA01" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 04 Dec 2008 06:01
Retrieved "3b8cA01" CATHEDRAL results for job ID SID8606647438766540 and inserted them into the database.
Domain scan cathedral cath by auto on 04 Dec 2008 05:58
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 670 results for 3b8cA01
Update comment by auto on 03 Dec 2008 23:44
"3b8cA01" CATHEDRAL job SID8606647438766540 is not yet finished.
Flow stage update by auto on 03 Dec 2008 23:37
The entry "3b8cA01" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 03 Dec 2008 23:37
The entry "3b8cA01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Dec 2008 20:54
Unable to retrieve "3b8cA01" CATHEDRAL results for job "SID0350043210516356"
Cathedral cath submit by auto on 03 Dec 2008 20:42
The entry "3b8cA01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Dec 2008 20:42
The entry "3b8cA01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Dec 2008 17:50
Unable to retrieve "3b8cA01" CATHEDRAL results for job "SID2680076034725184"
Flow stage update by auto on 03 Dec 2008 17:44
The entry "3b8cA01" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 03 Dec 2008 17:44
The entry "3b8cA01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Dec 2008 14:50
Unable to retrieve "3b8cA01" CATHEDRAL results for job "SID9256349763199520"
Update comment by auto on 03 Dec 2008 04:22
"3b8cA01" CATHEDRAL job SID9256349763199520 is not yet finished.
Flow stage update by auto on 03 Dec 2008 03:51
The entry "3b8cA01" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 03 Dec 2008 03:51
The entry "3b8cA01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 03 Dec 2008 00:41
Unable to retrieve "3b8cA01" CATHEDRAL results for job "SID8827927092295680"
Flow stage update by auto on 03 Dec 2008 00:12
The entry "3b8cA01" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 03 Dec 2008 00:12
The entry "3b8cA01" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 02 Dec 2008 23:35
ScanList with 12545 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3b8cA01.scanlist" for "3b8cA01"
Write scan list by auto on 02 Dec 2008 23:35
Writing ScanList containing 12545 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3b8cA01.scanlist" for domain "3b8cA01"
Update comment by auto on 02 Dec 2008 21:06
Waiting for 36 new domains (example : 3cmbB00) to be processed so that they can be scanned against too.
Update comment by auto on 02 Dec 2008 17:27
Waiting for 87 new domains (example : 3cjhE00) to be processed so that they can be scanned against too.
Flow stage update by auto on 02 Dec 2008 17:26
No satisfactory AssignClose result found.
Flow stage update by auto on 02 Dec 2008 17:08
No in_process hits for Domain "3b8cA01" ready to be processed
Flow stage update by auto on 02 Dec 2008 17:08
NW result present for Domain "3b8cA01"
Flow stage update by auto on 02 Dec 2008 11:07
All required files are present for Domain "3b8cA01"
Flow stage update by auto on 01 Dec 2008 17:53
Beginning processing for Domain "3b8cA01"
Insertion by cuff on 01 Dec 2008 16:41
nice chopping
