CATH Domain: 3b8bA02 XML data for domain: 3b8bA02

Molscript image for 3b8bA02
3b8bA02
PDB coordinates for domain 3b8bA02

PDB 3b8b, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.190 D-Maltodextrin-Binding Protein; domain 2
3.40.190.80 Gene3D
3.40.190.80.7
3.40.190.80.7.1
3.40.190.80.7.1.1
3.40.190.80.7.1.1.1
3.40.190.80.7.1.1.1.1

[top]
Segment boundaries for domain 3b8bA02

Chopping figure for domain 3b8bA02
DomainStart PDB ResidueStop PDB Residue
3b8bA01 -7 155
3b8bA02 157 267

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.40.190.80.7.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1inpA03 77.69 Inositol polyphosphate 1-phosphataseBos taurus 3.40.190.80 166 21 58 2.39 4.09
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3b8bA02
PLADARDHFIAVASRSHLTPETETYIADLKKKHGNVELISSGSSIKICLVAEGKADVYPRFAPTEWDTAAGHAIARAAGE
VYQAGKEEPLRYNKEDLLNPWFIVEAKRE
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3b8bA02
PLADARDHFIAVASRSHLTPETETYIADLKKKHGNVELISSGSSIKICLVAEGKADVYPRFAPTXEWDTAAGHAIARAAG
XEVYQAGKEEPLRYNKEDLLNPWFIVEAKRER
BLAST against CATH

[top]
Domain History Events (45)

Domain assigned by cuff on 05 Feb 2009 15:43

same superfamily

Domain assignment manual match h by cuff on 05 Feb 2009 15:41

same superfamily

Homcheck allotment by cuff on 05 Feb 2009 15:39

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 05 Feb 2009 15:39

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 28 Oct 2008 15:26

Domain "3b8bA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 28 Oct 2008 15:26

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3b8bA02

Flow stage update by auto on 28 Oct 2008 15:08

Retrieved PRC_PFAMCATH results for job ID SID3584095633363920 and results inserted.

Domain scan prc pfamcath by auto on 28 Oct 2008 15:08

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 14 results for 3b8bA02

Update comment by auto on 25 Oct 2008 09:41

PRC_PFAMCATH job SID3584095633363920 is not yet finished.

Flow stage update by auto on 25 Oct 2008 09:39

The entry "3b8bA02" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 25 Oct 2008 09:38

The entry "3b8bA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 25 Oct 2008 09:31

Retrieved SSAP results for job ID SID0730168067043424 and results inserted.

Domain scan ssap cath by auto on 25 Oct 2008 09:28

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1301 results for 3b8bA02

Update comment by auto on 23 Oct 2008 18:41

SSAP job SID0730168067043424 is not yet finished.

Flow stage update by auto on 23 Oct 2008 18:22

The entry "3b8bA02" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 23 Oct 2008 18:22

The entry "3b8bA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Oct 2008 17:59

Retrieved PRC results for job ID SID8526744172074688 and inserted them into the database.

Domain scan prc cath by auto on 23 Oct 2008 17:58

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 7 results for 3b8bA02

Update comment by auto on 23 Oct 2008 10:10

PRC job SID8526744172074688 is not yet finished.

Prc cath submit by auto on 23 Oct 2008 10:07

The entry "3b8bA02" has been submitted to the PRC webservice.

Flow stage update by auto on 23 Oct 2008 10:07

The entry "3b8bA02" has been submitted to the PRC webservice.

Flow stage update by auto on 23 Oct 2008 09:55

Retrieved HMM(SAM) results for job ID SID9715053310094688 and inserted them into the database.

Domain scan sam cath by auto on 23 Oct 2008 09:54

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 7 results for 3b8bA02

Update comment by auto on 22 Oct 2008 20:53

HMM(SAM) job SID9715053310094688 is not yet finished.

Sam cath submit by auto on 22 Oct 2008 20:51

The entry "3b8bA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Oct 2008 20:51

The entry "3b8bA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Oct 2008 20:42

Retrieved "3b8bA02" CATHEDRAL results for job ID SID2066780900862080 and inserted them into the database.

Domain scan cathedral cath by auto on 22 Oct 2008 20:41

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 14 results for 3b8bA02

Update comment by auto on 22 Oct 2008 14:41

"3b8bA02" CATHEDRAL job SID2066780900862080 is not yet finished.

Flow stage update by auto on 22 Oct 2008 14:34

The entry "3b8bA02" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 22 Oct 2008 14:34

The entry "3b8bA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Oct 2008 14:21

ScanList with 12259 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3b8bA02.scanlist" for "3b8bA02"

Write scan list by auto on 22 Oct 2008 14:20

Writing ScanList containing 12259 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3b8bA02.scanlist" for domain "3b8bA02"

Update comment by auto on 22 Oct 2008 11:51

Waiting for 14 new domains (example : 3dgvA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Oct 2008 09:11

Waiting for 42 new domains (example : 3cb5B01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Oct 2008 06:02

Waiting for 73 new domains (example : 3bjeA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Oct 2008 01:58

Waiting for 121 new domains (example : 3bgaA05) to be processed so that they can be scanned against too.

Update comment by auto on 21 Oct 2008 20:35

Waiting for 174 new domains (example : 3beeB00) to be processed so that they can be scanned against too.

Update comment by auto on 21 Oct 2008 18:34

Waiting for 225 new domains (example : 3b8sB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 21 Oct 2008 17:26

No satisfactory AssignClose result found.

Flow stage update by auto on 21 Oct 2008 17:08

No in_process hits for Domain "3b8bA02" ready to be processed

Flow stage update by auto on 21 Oct 2008 17:08

NW result present for Domain "3b8bA02"

Flow stage update by auto on 21 Oct 2008 08:34

All required files are present for Domain "3b8bA02"

Flow stage update by auto on 20 Oct 2008 18:49

Beginning processing for Domain "3b8bA02"

Insertion by cuff on 20 Oct 2008 16:24

nice chopping