CATH Domain: 3b8bA01 XML data for domain: 3b8bA01

Molscript image for 3b8bA01
3b8bA01
PDB coordinates for domain 3b8bA01

PDB 3b8b, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.540 Fructose-1,6-Bisphosphatase; Chain A, domain 1
3.30.540.10 Fructose-1,6-Bisphosphatase, subunit A, domain 1 Gene3D
3.30.540.10.5
3.30.540.10.5.1
3.30.540.10.5.1.1
3.30.540.10.5.1.1.1
3.30.540.10.5.1.1.1.1

[top]
Segment boundaries for domain 3b8bA01

Chopping figure for domain 3b8bA01
DomainStart PDB ResidueStop PDB Residue
3b8bA01 -7 155
3b8bA02 157 267

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.540.10.5.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1lbvA01 82.88 Inositol-1-monophosphataseArchaeoglobus fulgidusStreptomycin biosynthesisMyo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]Metabolic pathways 3.30.540.10 138 16 86 3.94 4.57
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3b8bA01
NLYFQSNAAAIDAALKAGEKILSIYEDPKSDFEIADNSPLTIADRKAHEAIVAILNETPFPVLSEEGKDYAVRRGWDTLW
IVDPLDGTKEFIKRNGEFTVNIALVQNAVPVGVIYVPVKKELYFAVEGTGAYKSGIVGLEDEGVTLQQIEKSER
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3b8bA01
NLYFQSNAXAAIDAALKAGEKILSIYEDPKSDFEIERKADNSPLTIADRKAHEAIVAILNETPFPVLSEEGKHXDYAVRR
GWDTLWIVDPLDGTKEFIKRNGEFTVNIALVQNAVPVXGVIYVPVKKELYFAVEGTGAYKXSGIVGLEDEGVTLQQXIEK
SER
BLAST against CATH

[top]
Domain History Events (45)

Domain assigned by cuff on 05 Feb 2009 15:36

same superfamily

Domain assignment manual match h by cuff on 05 Feb 2009 15:34

homology match

Homcheck allotment by cuff on 05 Feb 2009 15:31

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 05 Feb 2009 15:31

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 28 Oct 2008 15:25

Domain "3b8bA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 28 Oct 2008 15:25

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3b8bA01

Flow stage update by auto on 28 Oct 2008 15:09

Retrieved PRC_PFAMCATH results for job ID SID5980763255955040 and results inserted.

Domain scan prc pfamcath by auto on 28 Oct 2008 15:08

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 22 results for 3b8bA01

Update comment by auto on 25 Oct 2008 12:19

PRC_PFAMCATH job SID5980763255955040 is not yet finished.

Flow stage update by auto on 25 Oct 2008 12:17

The entry "3b8bA01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 25 Oct 2008 12:16

The entry "3b8bA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 25 Oct 2008 12:09

Retrieved SSAP results for job ID SID2878206378190208 and results inserted.

Domain scan ssap cath by auto on 25 Oct 2008 12:06

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1113 results for 3b8bA01

Update comment by auto on 23 Oct 2008 18:41

SSAP job SID2878206378190208 is not yet finished.

Ssap cath submit by auto on 23 Oct 2008 18:22

The entry "3b8bA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Oct 2008 18:22

The entry "3b8bA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Oct 2008 17:58

Retrieved PRC results for job ID SID8024001598011520 and inserted them into the database.

Domain scan prc cath by auto on 23 Oct 2008 17:58

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 9 results for 3b8bA01

Update comment by auto on 23 Oct 2008 10:10

PRC job SID8024001598011520 is not yet finished.

Prc cath submit by auto on 23 Oct 2008 10:07

The entry "3b8bA01" has been submitted to the PRC webservice.

Flow stage update by auto on 23 Oct 2008 10:07

The entry "3b8bA01" has been submitted to the PRC webservice.

Flow stage update by auto on 23 Oct 2008 09:54

Retrieved HMM(SAM) results for job ID SID5197467922240816 and inserted them into the database.

Domain scan sam cath by auto on 23 Oct 2008 09:54

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 8 results for 3b8bA01

Update comment by auto on 22 Oct 2008 20:53

HMM(SAM) job SID5197467922240816 is not yet finished.

Sam cath submit by auto on 22 Oct 2008 20:51

The entry "3b8bA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Oct 2008 20:51

The entry "3b8bA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Oct 2008 20:41

Retrieved "3b8bA01" CATHEDRAL results for job ID SID9296586375203744 and inserted them into the database.

Domain scan cathedral cath by auto on 22 Oct 2008 20:41

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 64 results for 3b8bA01

Update comment by auto on 22 Oct 2008 14:41

"3b8bA01" CATHEDRAL job SID9296586375203744 is not yet finished.

Cathedral cath submit by auto on 22 Oct 2008 14:34

The entry "3b8bA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Oct 2008 14:34

The entry "3b8bA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Oct 2008 14:20

ScanList with 12259 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3b8bA01.scanlist" for "3b8bA01"

Write scan list by auto on 22 Oct 2008 14:20

Writing ScanList containing 12259 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3b8bA01.scanlist" for domain "3b8bA01"

Update comment by auto on 22 Oct 2008 11:51

Waiting for 14 new domains (example : 3dgvA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Oct 2008 09:11

Waiting for 42 new domains (example : 3cb5B01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Oct 2008 06:02

Waiting for 73 new domains (example : 3bjeA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Oct 2008 01:58

Waiting for 121 new domains (example : 3bgaA05) to be processed so that they can be scanned against too.

Update comment by auto on 21 Oct 2008 20:35

Waiting for 174 new domains (example : 3beeB00) to be processed so that they can be scanned against too.

Update comment by auto on 21 Oct 2008 18:34

Waiting for 225 new domains (example : 3b8sB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 21 Oct 2008 17:26

No satisfactory AssignClose result found.

Flow stage update by auto on 21 Oct 2008 17:08

No in_process hits for Domain "3b8bA01" ready to be processed

Flow stage update by auto on 21 Oct 2008 17:08

NW result present for Domain "3b8bA01"

Flow stage update by auto on 21 Oct 2008 08:34

All required files are present for Domain "3b8bA01"

Flow stage update by auto on 20 Oct 2008 18:49

Beginning processing for Domain "3b8bA01"

Insertion by cuff on 20 Oct 2008 16:24

nice chopping