CATH Domain: 3b89A01 XML data for domain: 3b89A01

Molscript image for 3b89A01
3b89A01
PDB coordinates for domain 3b89A01

PDB 3b89, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.8 Helicase, Ruva Protein; domain 3
1.10.8.10 DNA helicase RuvA subunit, C-terminal domain Gene3D
1.10.8.10.2
1.10.8.10.2.1
1.10.8.10.2.1.1
1.10.8.10.2.1.1.2
1.10.8.10.2.1.1.2.1

[top]
Segment boundaries for domain 3b89A01

Chopping figure for domain 3b89A01
DomainStart PDB ResidueStop PDB Residue
3b89A01 2 55
3b89A02 57 250

Structural Neighbourhood (36 entries)

There are 36 matching structural neighberhood comparisons for CATH ID 1.10.8.10.2.1.1.2.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 36 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2h5xA03 88.39 Homologous recombinationHolliday junction ATP-dependent DNA helicase ruvAHolliday junction DNA helicase RuvAMycobacterium tuberculosis 1.10.8.10 50 4 82 2.04 2.46
2ztdA03 88.14 Homologous recombinationHolliday junction ATP-dependent DNA helicase ruvAHolliday junction DNA helicase RuvAMycobacterium tuberculosis 1.10.8.10 50 4 82 2.03 2.45
1ixrB03 86.66 Homologous recombinationThermus thermophilus HB8Holliday junction ATP-dependent DNA helicase ruvAHolliday junction DNA helicase RuvAProtein binding 1.10.8.10 53 11 82 2.39 2.89
1otrA00 85.10 Saccharomyces cerevisiaeProtein bindingUbiquitin-binding protein CUE2 1.10.8.10 49 10 82 2.20 2.66
1a5tA02 84.64 Pyrimidine metabolismDNA replicationPurine metabolismMetabolic pathwaysHomologous recombination 1.10.8.10 40 17 68 1.89 2.74
1efuB01 84.63 CytoplasmMembraneZinc ion bindingElongation factor EF-TsElongation factor Ts 1.10.8.10 54 12 79 3.00 3.78
1cukA03 84.63 Homologous recombinationHolliday junction ATP-dependent DNA helicase ruvAHolliday junction DNA helicase RuvAEscherichia coli K-12 1.10.8.10 48 12 82 3.47 4.19
1djxB01 83.98 Calcium ion bindingCalcium signaling pathwayPhosphatidylinositol signaling systemRattus norvegicusElevation of cytosolic calcium ion concentration involved in G-protein signaling coupled to IP3 second messenger 1.10.238.10 52 13 86 3.00 3.48
1bvsF03 83.62 Homologous recombinationHolliday junction ATP-dependent DNA helicase ruvAMycobacterium lepraeHolliday junction DNA helicase RuvA 1.10.8.10 45 6 77 1.89 2.44
1sxjE02 83.49 Leading strand elongationNucleotide excision repairDNA replicationReplication factor C subunit 3/5Sister chromatid cohesion 1.10.8.60 64 12 75 2.39 3.19
1dv0A00 83.27 Nucleotide excision repairNucleotide-excision repairUV excision repair protein RAD23 homolog ASingle-stranded DNA bindingHomo sapiens 1.10.8.10 45 11 75 2.90 3.82
1s26D01 82.39 Calcium signaling pathwayPhosphatidylinositol signaling systemOocyte meiosisMelanogenesisInsulin signaling pathway 1.10.238.10 59 5 88 3.08 3.49
1njgA02 82.19 Pyrimidine metabolismDNA replicationPurine metabolismMetabolic pathwaysHomologous recombination 1.10.8.60 66 5 74 2.60 3.50
2chgA02 81.82 Archaeoglobus fulgidusReplication factor C small subunitReplication factor C small subunit 1.10.8.60 66 10 74 2.17 2.92
1tteA02 81.24 Ubiquitin-conjugating enzyme E2-24 kDaIdentical protein bindingProtein polyubiquitinationUbiquitin-conjugating enzyme (huntingtin interacting protein 2) [EC:6.3.2.19]Ubiquitin mediated proteolysis 1.10.8.10 57 8 77 3.54 4.56
1xvhA02 80.79 Extracellular matrix-binding protein ebhStaphylococcus aureus subsp. aureus MW2 1.20.5.420 55 7 89 3.83 4.27
1sxjD02 80.45 DNA replicationNucleotide excision repairLeading strand elongationCell cycle checkpointProtein binding 1.10.8.60 70 10 68 2.25 3.28
1njgB01 80.42 Pyrimidine metabolismDNA replicationPurine metabolismMetabolic pathwaysHomologous recombination 1.10.8.60 73 6 69 2.96 4.24
1v92A00 80.06 Rattus norvegicusGolgi organizationCellular membrane fusionNSFL1 cofactor p47Protein binding 1.10.8.10 46 19 79 3.57 4.50
1t6oA00 80.06 Measles virus strain MoratenPhosphoprotein 1.10.8.10 49 8 84 4.03 4.77
1tizA00 80.00 Calcium-binding protein CMLArabidopsis thalianaPlant-pathogen interactionProbable calcium-binding protein CML34 1.10.238.10 66 5 74 2.82 3.80
1in4A03 79.92 Holliday junction DNA helicase RuvBThermotoga maritimaHomologous recombinationHolliday junction ATP-dependent DNA helicase ruvB 1.10.8.60 75 6 64 2.56 4.00
1r6bX03 79.90 ATP-dependent Clp protease ATP-binding subunit clpAATP-dependent Clp protease ATP-binding subunit ClpAProtein bindingEscherichia coli K-12 1.10.8.60 88 12 59 2.36 3.99
1deeG00 79.08 Staphylococcus aureus subsp. aureus NCTC 8325Immunoglobulin G-binding protein A 1.20.5.420 51 7 82 3.62 4.37
1lp1B00 79.06 Staphylococcus aureusImmunoglobulin G-binding protein A 1.20.5.420 54 3 89 4.42 4.93
1sxjC02 77.91 Nucleotide excision repairDNA replicationLeading strand elongationReplication factor C subunit 3Replication factor C subunit 3/5 1.10.8.60 69 8 69 2.36 3.39
1okkD01 77.53 Cell division protein ftsYThermus aquaticusProtein binding 1.20.120.140 58 12 87 3.34 3.80
1m45A01 76.89 Vesicle targetingIdentical protein bindingProtein localizationMyosin II heavy chain bindingMyosin light chain 1 1.10.238.10 67 1 70 3.35 4.78
2hwjA02 76.51 Agrobacterium tumefaciens str. C58Putative uncharacterized protein 1.10.8.10 59 6 89 4.27 4.75
3doaA02 76.22 Fibrinogen binding proteinStaphylococcus aureus subsp. aureus Mu50 1.10.8.50 70 8 74 3.42 4.60
1k32A03 76.18 Tricorn proteaseTricorn protease [EC:3.4.21.-]Thermoplasma acidophilum 3.30.750.44 72 5 68 3.24 4.76
1qzmA00 75.91 Serine-type endopeptidase activityATP-dependent Lon protease [EC:3.4.21.53]ATP-dependent protease LaResponse to heatProteolysis 1.10.8.60 94 6 56 2.79 4.95
3bosA02 75.51 DnaA-homolog proteinShewanella amazonensis SB2BRegulatory inactivation of DnaA Hda protein 1.10.8.60 59 6 83 4.13 4.97
2j5yA00 74.95 Peptostreptococcal albumin-binding proteinFinegoldia magna 1.10.8.40 61 12 81 3.69 4.50
1um8A02 73.71 Helicobacter pyloriATP-dependent Clp protease ATP-binding subunit clpXATP-dependent Clp protease ATP-binding subunit ClpX 1.10.8.60 97 6 54 2.50 4.58
1l8qA02 73.30 Two-component systemChromosomal replication initiator proteinChromosomal replication initiator protein dnaAAquifex aeolicus 1.10.8.60 49 6 81 3.56 4.39
[1]
Displaying entries 1 to 36 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3b89A01
NINDALTSILASKKYRALCPDTVRRILTEEWGRHKSPKQTVEAARTRLHGICGA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3b89A01
SLNINDALTSILASKKYRALCPDTVRRILTEEWGRHKSPKQTVEAARTRLHGICGA
BLAST against CATH

[top]
Domain History Events (45)

Domain assigned by cuff on 05 Feb 2009 15:13

homology match

Domain assignment manual match h by cuff on 05 Feb 2009 15:12

same superfamily

Homcheck allotment by cuff on 05 Feb 2009 15:11

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 05 Feb 2009 15:11

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 28 Oct 2008 15:25

Domain "3b89A01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 28 Oct 2008 15:24

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3b89A01

Flow stage update by auto on 28 Oct 2008 15:08

Retrieved PRC_PFAMCATH results for job ID SID2771739922776992 and results inserted.

Domain scan prc pfamcath by auto on 28 Oct 2008 15:07

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 62 results for 3b89A01

Update comment by auto on 25 Oct 2008 00:30

PRC_PFAMCATH job SID2771739922776992 is not yet finished.

Flow stage update by auto on 25 Oct 2008 00:28

The entry "3b89A01" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 25 Oct 2008 00:28

The entry "3b89A01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 25 Oct 2008 00:15

Retrieved SSAP results for job ID SID6915028488414272 and results inserted.

Domain scan ssap cath by auto on 25 Oct 2008 00:04

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2771 results for 3b89A01

Update comment by auto on 23 Oct 2008 18:41

SSAP job SID6915028488414272 is not yet finished.

Ssap cath submit by auto on 23 Oct 2008 18:21

The entry "3b89A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Oct 2008 18:21

The entry "3b89A01" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Oct 2008 17:56

Retrieved PRC results for job ID SID2334371629461856 and inserted them into the database.

Domain scan prc cath by auto on 23 Oct 2008 17:56

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 1 results for 3b89A01

Update comment by auto on 23 Oct 2008 10:10

PRC job SID2334371629461856 is not yet finished.

Flow stage update by auto on 23 Oct 2008 10:06

The entry "3b89A01" has been submitted to the PRC webservice.

Prc cath submit by auto on 23 Oct 2008 10:06

The entry "3b89A01" has been submitted to the PRC webservice.

Flow stage update by auto on 23 Oct 2008 09:52

Retrieved HMM(SAM) results for job ID SID2826455005705200 and inserted them into the database.

Domain scan sam cath by auto on 23 Oct 2008 09:52

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 1 results for 3b89A01

Update comment by auto on 22 Oct 2008 20:53

HMM(SAM) job SID2826455005705200 is not yet finished.

Flow stage update by auto on 22 Oct 2008 20:50

The entry "3b89A01" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 22 Oct 2008 20:50

The entry "3b89A01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Oct 2008 20:39

Retrieved "3b89A01" CATHEDRAL results for job ID SID2119238564857760 and inserted them into the database.

Domain scan cathedral cath by auto on 22 Oct 2008 20:38

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 164 results for 3b89A01

Update comment by auto on 22 Oct 2008 14:41

"3b89A01" CATHEDRAL job SID2119238564857760 is not yet finished.

Cathedral cath submit by auto on 22 Oct 2008 14:33

The entry "3b89A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Oct 2008 14:33

The entry "3b89A01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Oct 2008 14:20

ScanList with 12259 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3b89A01.scanlist" for "3b89A01"

Write scan list by auto on 22 Oct 2008 14:20

Writing ScanList containing 12259 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3b89A01.scanlist" for domain "3b89A01"

Update comment by auto on 22 Oct 2008 11:51

Waiting for 14 new domains (example : 3dgvA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Oct 2008 09:11

Waiting for 42 new domains (example : 3cb5B01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Oct 2008 06:02

Waiting for 73 new domains (example : 3bjeA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Oct 2008 01:58

Waiting for 121 new domains (example : 3bgaA05) to be processed so that they can be scanned against too.

Update comment by auto on 21 Oct 2008 20:35

Waiting for 174 new domains (example : 3beeB00) to be processed so that they can be scanned against too.

Update comment by auto on 21 Oct 2008 18:34

Waiting for 225 new domains (example : 3b8sB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 21 Oct 2008 17:26

No satisfactory AssignClose result found.

Flow stage update by auto on 21 Oct 2008 17:08

No in_process hits for Domain "3b89A01" ready to be processed

Flow stage update by auto on 21 Oct 2008 17:08

NW result present for Domain "3b89A01"

Flow stage update by auto on 21 Oct 2008 08:34

All required files are present for Domain "3b89A01"

Flow stage update by auto on 20 Oct 2008 18:49

Beginning processing for Domain "3b89A01"

Insertion by cuff on 20 Oct 2008 16:24

nice chopping