CATH Domain: 3b7xA00 XML data for domain: 3b7xA00

Molscript image for 3b7xA00
3b7xA00
PDB coordinates for domain 3b7xA00

PDB 3b7x, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.50 Chitinase A; domain 3
3.10.50.40 Gene3D
3.10.50.40.6
3.10.50.40.6.1
3.10.50.40.6.1.1
3.10.50.40.6.1.1.1
3.10.50.40.6.1.1.1.1

[top]
Segment boundaries for domain 3b7xA00

Chopping figure for domain 3b7xA00
DomainStart PDB ResidueStop PDB Residue
3b7xA00 19 143

Structural Neighbourhood (3 entries)

There are 3 matching structural neighberhood comparisons for CATH ID 3.10.50.40.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 3 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1jvwA00 84.09 Macrophage infectivity potentiatorTrypanosoma cruzi 3.10.50.40 160 24 70 1.89 2.68
1hxvA00 76.54 Trigger factorTrigger factorMycoplasma genitalium 3.10.50.40 85 15 69 2.94 4.25
1okgA03 74.89 3-mercaptopyruvate sulfurtransferase [EC:2.8.1.2]Cysteine and methionine metabolismMercaptopyruvate sulfurtransferaseLeishmania majorMetabolic pathways 3.30.1670.10 66 12 51 2.44 4.76
[1]
Displaying entries 1 to 3 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3b7xA00
QSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDASVLVKYSGYLEHMDRPFDSNLMKLEDITLWGMELGLLSMRRGE
LARFLFKPNYAYGTLGCPPLIPPNTTVLFEIELLDFL
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3b7xA00
GEGDDAPGQSLYERLSQRMLDISGDRGVLKDVIREGAGDLVAPDASVLVKYSGYLEHMDRPFDSNYFRKTPRLMKLGEDI
TLWGMELGLLSMRRGELARFLFKPNYAYGTLGCPPLIPPNTTVLFEIELLDFLD
BLAST against CATH

[top]
Domain History Events (42)

Domain assigned by cuff on 05 Feb 2009 15:05

same superfamily

Domain assignment manual match h by cuff on 05 Feb 2009 15:04

homology match

Homcheck allotment by cuff on 05 Feb 2009 15:01

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 05 Feb 2009 15:01

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 20 Oct 2008 19:40

Domain "3b7xA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 20 Oct 2008 19:40

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3b7xA00

Flow stage update by auto on 20 Oct 2008 19:38

Retrieved PRC_PFAMCATH results for job ID SID6182145731690576 and results inserted.

Domain scan prc pfamcath by auto on 20 Oct 2008 19:38

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 10 results for 3b7xA00

Update comment by auto on 20 Oct 2008 16:36

PRC_PFAMCATH job SID6182145731690576 is not yet finished.

Flow stage update by auto on 20 Oct 2008 16:36

The entry "3b7xA00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 20 Oct 2008 16:36

The entry "3b7xA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 20 Oct 2008 16:33

Retrieved SSAP results for job ID SID5220698115599152 and results inserted.

Domain scan ssap cath by auto on 20 Oct 2008 16:30

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1622 results for 3b7xA00

Update comment by auto on 16 Oct 2008 00:11

SSAP job SID5220698115599152 is not yet finished.

Ssap cath submit by auto on 15 Oct 2008 23:54

The entry "3b7xA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Oct 2008 23:54

The entry "3b7xA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Oct 2008 23:51

Retrieved PRC results for job ID SID2276466145893430 and inserted them into the database.

Domain scan prc cath by auto on 15 Oct 2008 23:50

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 10 results for 3b7xA00

Flow stage update by auto on 15 Oct 2008 23:39

The entry "3b7xA00" has been submitted to the PRC webservice.

Prc cath submit by auto on 15 Oct 2008 23:39

The entry "3b7xA00" has been submitted to the PRC webservice.

Flow stage update by auto on 15 Oct 2008 23:35

Retrieved HMM(SAM) results for job ID SID6324354774397690 and inserted them into the database.

Domain scan sam cath by auto on 15 Oct 2008 23:34

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 10 results for 3b7xA00

Update comment by auto on 15 Oct 2008 20:48

HMM(SAM) job SID6324354774397690 is not yet finished.

Flow stage update by auto on 15 Oct 2008 20:40

The entry "3b7xA00" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 15 Oct 2008 20:40

The entry "3b7xA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 15 Oct 2008 20:38

Retrieved "3b7xA00" CATHEDRAL results for job ID SID7109704845344552 and inserted them into the database.

Domain scan cathedral cath by auto on 15 Oct 2008 20:38

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 327 results for 3b7xA00

Update comment by auto on 13 Oct 2008 17:59

"3b7xA00" CATHEDRAL job SID7109704845344552 is not yet finished.

Cathedral cath submit by auto on 13 Oct 2008 17:57

The entry "3b7xA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 13 Oct 2008 17:57

The entry "3b7xA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 13 Oct 2008 17:54

ScanList with 12158 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3b7xA00.scanlist" for "3b7xA00"

Write scan list by auto on 13 Oct 2008 17:54

Writing ScanList containing 12158 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3b7xA00.scanlist" for domain "3b7xA00"

Update comment by auto on 13 Oct 2008 14:39

Waiting for 7 new domains (example : 3emjH00) to be processed so that they can be scanned against too.

Update comment by auto on 13 Oct 2008 10:34

Waiting for 105 new domains (example : 3d5d600) to be processed so that they can be scanned against too.

Update comment by auto on 13 Oct 2008 06:03

Waiting for 143 new domains (example : 3d5aS00) to be processed so that they can be scanned against too.

Update comment by auto on 13 Oct 2008 03:39

Waiting for 192 new domains (example : 3cksA00) to be processed so that they can be scanned against too.

Flow stage update by auto on 12 Oct 2008 23:44

No satisfactory AssignClose result found.

Flow stage update by auto on 12 Oct 2008 23:14

No in_process hits for Domain "3b7xA00" ready to be processed

Flow stage update by auto on 12 Oct 2008 23:14

NW result present for Domain "3b7xA00"

Flow stage update by auto on 11 Oct 2008 08:41

All required files are present for Domain "3b7xA00"

Flow stage update by auto on 10 Oct 2008 17:39

Beginning processing for Domain "3b7xA00"

Insertion by cuff on 10 Oct 2008 15:17

nice chopping