CATH Domain: 3b7fA00 XML data for domain: 3b7fA00

Molscript image for 3b7fA00
3b7fA00
PDB coordinates for domain 3b7fA00

PDB 3b7f, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.130 7 Propellor
2.130.10 Methylamine Dehydrogenase; Chain H
2.130.10.10 YVTN repeat-like/Quinoprotein amine dehydrogenase Gene3D
2.130.10.10.12
2.130.10.10.12.1
2.130.10.10.12.1.1
2.130.10.10.12.1.1.1
2.130.10.10.12.1.1.1.1

[top]
Segment boundaries for domain 3b7fA00

Chopping figure for domain 3b7fA00
DomainStart PDB ResidueStop PDB Residue
3b7fA00 15 392

Structural Neighbourhood (4 entries)

There are 4 matching structural neighberhood comparisons for CATH ID 2.130.10.10.12.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 4 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1ri6A00 76.93 Pentose phosphate pathwayMetabolic pathways6-phosphogluconolactonase [EC:3.1.1.31]6-phosphogluconolactonase activity6-phosphogluconolactonase 2.130.10.10 333 9 82 2.94 3.57
1l0qA01 76.21 Methanosarcina mazeiORF492 2.130.10.10 295 10 79 3.01 3.81
1jofA00 74.18 Neurospora crassaCarboxy-cis,cis-muconate cyclase 2.130.10.10 355 7 83 3.41 4.06
1p22A02 73.65 Ubiquitin-dependent protein catabolic processF-box/WD repeat-containing protein 1AHomo sapiensProtein bindingSignal transduction 2.130.10.10 295 10 72 3.23 4.45
[1]
Displaying entries 1 to 4 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3b7fA00
SAPESGPVLLVATIKGAWFLASDPARRTWELRGPVFLGHTIHHIVQDPREPERLAARTLGPTVFRSDDGGGNWTEATRPP
AFNKAPGRVVDHVFWLTPGHASEPGTWYAGTSPQGLFRSTDHGASWEPVAGFNDHPRRAWTGGEPDGPKHSILVDPRDPK
HLYIGSSGGVFESTDAGTDWKPLNRGCAANFLPDPNVEFGHDPHCVVQHPAAPDILYQQNHCGIYRDRREGVWKRIGDAP
REVGDIGFPIVVHQRDPRTVWVFPDGSDVWPRVSPGGKPAVYVTRDAGESWQRQDRGLPTDQAWLTVKRQATADAHAPVG
VYFGTTGGEIWASADEGEHWQCIASHLPHIYAVQSARP
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3b7fA00
GXTASTAPQTEPHKTSAPESGPVXLLVATIKGAWFLASDPARRTWELRGPVFLGHTIHHIVQDPREPERXLXAARTGHLG
PTVFRSDDGGGNWTEATRPPAFNKAPEGETGRVVDHVFWLTPGHASEPGTWYAGTSPQGLFRSTDHGASWEPVAGFNDHP
XRRAWTGGEQDGTPDGPKXHSILVDPRDPKHLYIGXSSGGVFESTDAGTDWKPLNRGCAANFLPDPNVEFGHDPHCVVQH
PAAPDILYQQNHCGIYRXDRREGVWKRIGDAXPREVGDIGFPIVVHQRDPRTVWVFPXDGSDVWPRVSPGGKPAVYVTRD
AGESWQRQDRGLPTDQAWLTVKRQAXTADAHAPVGVYFGTTGGEIWASADEGEHWQCIASHLPHIYAVQSARPV
BLAST against CATH

[top]
Domain History Events (45)

Domain assigned by cuff on 05 Feb 2009 14:46

same superfamily

Domain assignment manual match h by cuff on 05 Feb 2009 14:42

homology match

Homcheck allotment by cuff on 05 Feb 2009 14:41

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 05 Feb 2009 14:41

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 28 Oct 2008 19:15

Domain "3b7fA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 28 Oct 2008 19:15

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3b7fA00

Flow stage update by auto on 28 Oct 2008 18:44

Retrieved PRC_PFAMCATH results for job ID SID2826378687299912 and results inserted.

Domain scan prc pfamcath by auto on 28 Oct 2008 18:44

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 12 results for 3b7fA00

Update comment by auto on 27 Oct 2008 06:06

PRC_PFAMCATH job SID2826378687299912 is not yet finished.

Flow stage update by auto on 27 Oct 2008 06:04

The entry "3b7fA00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 27 Oct 2008 06:04

The entry "3b7fA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 27 Oct 2008 05:53

Retrieved SSAP results for job ID SID6533080517906080 and results inserted.

Domain scan ssap cath by auto on 27 Oct 2008 05:52

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 80 results for 3b7fA00

Update comment by auto on 23 Oct 2008 18:41

SSAP job SID6533080517906080 is not yet finished.

Flow stage update by auto on 23 Oct 2008 18:21

The entry "3b7fA00" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 23 Oct 2008 18:21

The entry "3b7fA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Oct 2008 17:55

Retrieved PRC results for job ID SID2595733791970560 and inserted them into the database.

Domain scan prc cath by auto on 23 Oct 2008 17:54

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 10 results for 3b7fA00

Update comment by auto on 23 Oct 2008 10:09

PRC job SID2595733791970560 is not yet finished.

Prc cath submit by auto on 23 Oct 2008 10:06

The entry "3b7fA00" has been submitted to the PRC webservice.

Flow stage update by auto on 23 Oct 2008 10:06

The entry "3b7fA00" has been submitted to the PRC webservice.

Flow stage update by auto on 23 Oct 2008 09:51

Retrieved HMM(SAM) results for job ID SID5503062591767040 and inserted them into the database.

Domain scan sam cath by auto on 23 Oct 2008 09:51

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 9 results for 3b7fA00

Update comment by auto on 22 Oct 2008 20:53

HMM(SAM) job SID5503062591767040 is not yet finished.

Sam cath submit by auto on 22 Oct 2008 20:50

The entry "3b7fA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Oct 2008 20:50

The entry "3b7fA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Oct 2008 20:37

Retrieved "3b7fA00" CATHEDRAL results for job ID SID1794826871840344 and inserted them into the database.

Domain scan cathedral cath by auto on 22 Oct 2008 20:37

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 51 results for 3b7fA00

Update comment by auto on 22 Oct 2008 14:41

"3b7fA00" CATHEDRAL job SID1794826871840344 is not yet finished.

Cathedral cath submit by auto on 22 Oct 2008 14:33

The entry "3b7fA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Oct 2008 14:33

The entry "3b7fA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Oct 2008 14:19

ScanList with 12259 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3b7fA00.scanlist" for "3b7fA00"

Write scan list by auto on 22 Oct 2008 14:19

Writing ScanList containing 12259 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3b7fA00.scanlist" for domain "3b7fA00"

Update comment by auto on 22 Oct 2008 11:51

Waiting for 14 new domains (example : 3dgvA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Oct 2008 09:11

Waiting for 42 new domains (example : 3cb5B01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Oct 2008 06:02

Waiting for 73 new domains (example : 3bjeA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Oct 2008 01:58

Waiting for 121 new domains (example : 3bgaA05) to be processed so that they can be scanned against too.

Update comment by auto on 21 Oct 2008 20:35

Waiting for 174 new domains (example : 3beeB00) to be processed so that they can be scanned against too.

Update comment by auto on 21 Oct 2008 18:34

Waiting for 225 new domains (example : 3b8sB01) to be processed so that they can be scanned against too.

Flow stage update by auto on 21 Oct 2008 17:25

No satisfactory AssignClose result found.

Flow stage update by auto on 21 Oct 2008 17:08

No in_process hits for Domain "3b7fA00" ready to be processed

Flow stage update by auto on 21 Oct 2008 17:08

NW result present for Domain "3b7fA00"

Flow stage update by auto on 21 Oct 2008 08:34

All required files are present for Domain "3b7fA00"

Flow stage update by auto on 20 Oct 2008 18:49

Beginning processing for Domain "3b7fA00"

Insertion by cuff on 20 Oct 2008 16:52

nice chopping