CATH Domain: 3b7cA00 XML data for domain: 3b7cA00

Molscript image for 3b7cA00
3b7cA00
PDB coordinates for domain 3b7cA00

PDB 3b7c, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.450 Nuclear Transport Factor 2; Chain: A,
3.10.450.50 Gene3D
3.10.450.50.21
3.10.450.50.21.1
3.10.450.50.21.1.1
3.10.450.50.21.1.1.1
3.10.450.50.21.1.1.1.1

[top]
Segment boundaries for domain 3b7cA00

Chopping figure for domain 3b7cA00
DomainStart PDB ResidueStop PDB Residue
3b7cA00 2 121

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 3.10.450.50.21.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 10 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2ux0B00 82.70 Calcium/calmodulin-dependent protein kinase type II subunit gammaHomo sapiensCalcium- and calmodulin-dependent protein kinase complex 3.10.450.50 136 15 83 2.55 3.04
1m98A02 82.59 Arthrospira maximaOrange carotenoid-binding protein 3.10.450.50 128 7 83 3.20 3.83
2owpA00 82.47 Burkholderia xenovorans LB400Putative uncharacterized protein 3.10.450.50 124 12 85 2.93 3.43
3cu3A00 82.23 Domain of unknown function with a cystatin-like foldNostoc punctiforme PCC 73102 3.10.450.50 160 15 70 2.57 3.64
1vqqB01 81.63 Staphylococcus aureusPenicillin binding protein 2' 3.10.450.100 103 12 81 2.96 3.62
2jq5A00 78.28 SEC-C motifSEC-C motif domain proteinRhodopseudomonas palustris 3.10.450.50 128 8 78 3.19 4.08
1of5B00 77.09 Nuclear poreNuclear RNA export factor complexMRNA transport regulator MTR2Ribosomal large subunit export from nucleusSaccharomyces cerevisiae 3.10.450.50 128 7 85 3.70 4.31
2qguA01 76.53 Probable signal peptide proteinRalstonia solanacearum 3.10.450.50 101 9 66 2.64 3.99
2bmoB00 76.18 Oxygenase-beta NBDOComamonas sp. JS765Protein binding 3.10.450.50 194 7 57 2.44 4.23
1q40D00 75.24 MRNA export factor MEX67Candida albicans 3.10.450.50 169 7 62 2.80 4.51
[1]
Displaying entries 1 to 10 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3b7cA00
PTDDIVQLLKGQEEAWNRGDLDAYQGYWQNEQLLISNGKFRNGWDETLAAYKKNYPDKESLGELKFTIKEIKLSNYAAVV
GRWDLKRLKDTPTGVFTLLVEKIDDRWVITDHSSD
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3b7cA00
GXPTDDIVQLLKGQEEAWNRGDLDAYXQGYWQNEQLXLISNGKFRNGWDETLAAYKKNYPDKESLGELKFTIKEIKXLSN
YAAXVVGRWDLKRLKDTPTGVFTLLVEKIDDRWVITXDHSSD
BLAST against CATH

[top]
Domain History Events (43)

Domain assigned by cuff on 05 Feb 2009 14:40

same superfamily

Domain assignment manual match h by cuff on 05 Feb 2009 14:39

homology match

Homcheck allotment by cuff on 05 Feb 2009 14:38

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 05 Feb 2009 14:38

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Oct 2008 11:54

Domain "3b7cA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Oct 2008 11:53

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3b7cA00

Flow stage update by auto on 19 Oct 2008 11:51

Retrieved PRC_PFAMCATH results for job ID SID1987727563871260 and results inserted.

Domain scan prc pfamcath by auto on 19 Oct 2008 11:51

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 11 results for 3b7cA00

Update comment by auto on 19 Oct 2008 09:06

PRC_PFAMCATH job SID1987727563871260 is not yet finished.

Prc pfamcath submit by auto on 19 Oct 2008 09:06

The entry "3b7cA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 19 Oct 2008 09:06

The entry "3b7cA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 19 Oct 2008 09:03

Retrieved SSAP results for job ID SID3283833075195296 and results inserted.

Domain scan ssap cath by auto on 19 Oct 2008 08:58

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2483 results for 3b7cA00

Update comment by auto on 16 Oct 2008 00:11

SSAP job SID3283833075195296 is not yet finished.

Ssap cath submit by auto on 15 Oct 2008 23:54

The entry "3b7cA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Oct 2008 23:54

The entry "3b7cA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 15 Oct 2008 23:49

Retrieved PRC results for job ID SID2676741887218848 and inserted them into the database.

Domain scan prc cath by auto on 15 Oct 2008 23:49

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 6 results for 3b7cA00

Prc cath submit by auto on 15 Oct 2008 23:38

The entry "3b7cA00" has been submitted to the PRC webservice.

Flow stage update by auto on 15 Oct 2008 23:38

The entry "3b7cA00" has been submitted to the PRC webservice.

Flow stage update by auto on 15 Oct 2008 23:34

Retrieved HMM(SAM) results for job ID SID0993417150478018 and inserted them into the database.

Domain scan sam cath by auto on 15 Oct 2008 23:33

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 3 results for 3b7cA00

Update comment by auto on 15 Oct 2008 20:48

HMM(SAM) job SID0993417150478018 is not yet finished.

Sam cath submit by auto on 15 Oct 2008 20:40

The entry "3b7cA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 15 Oct 2008 20:40

The entry "3b7cA00" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 15 Oct 2008 20:37

Retrieved "3b7cA00" CATHEDRAL results for job ID SID4613454535923936 and inserted them into the database.

Domain scan cathedral cath by auto on 15 Oct 2008 20:36

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 257 results for 3b7cA00

Update comment by auto on 13 Oct 2008 17:58

"3b7cA00" CATHEDRAL job SID4613454535923936 is not yet finished.

Cathedral cath submit by auto on 13 Oct 2008 17:56

The entry "3b7cA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 13 Oct 2008 17:56

The entry "3b7cA00" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 13 Oct 2008 17:54

ScanList with 12158 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/3b7cA00.scanlist" for "3b7cA00"

Write scan list by auto on 13 Oct 2008 17:53

Writing ScanList containing 12158 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/3b7cA00.scanlist" for domain "3b7cA00"

Update comment by auto on 13 Oct 2008 14:39

Waiting for 7 new domains (example : 3emjH00) to be processed so that they can be scanned against too.

Update comment by auto on 13 Oct 2008 10:34

Waiting for 105 new domains (example : 3d5d600) to be processed so that they can be scanned against too.

Update comment by auto on 13 Oct 2008 06:03

Waiting for 143 new domains (example : 3d5aS00) to be processed so that they can be scanned against too.

Update comment by auto on 13 Oct 2008 03:39

Waiting for 192 new domains (example : 3cksA00) to be processed so that they can be scanned against too.

Update comment by auto on 12 Oct 2008 21:33

Waiting for 233 new domains (example : 3b7kC01) to be processed so that they can be scanned against too.

Flow stage update by auto on 12 Oct 2008 21:32

No satisfactory AssignClose result found.

Flow stage update by auto on 12 Oct 2008 21:11

No in_process hits for Domain "3b7cA00" ready to be processed

Flow stage update by auto on 12 Oct 2008 21:11

NW result present for Domain "3b7cA00"

Flow stage update by auto on 11 Oct 2008 08:41

All required files are present for Domain "3b7cA00"

Flow stage update by auto on 10 Oct 2008 17:39

Beginning processing for Domain "3b7cA00"

Insertion by cuff on 10 Oct 2008 15:17

nice chopping