CATH Domain: 3b4uA00

3b4uA00

PDB 3b4u, Chain A, Domain 0

CATH Code	Level Description	Links
3	Alpha Beta
3.20	Alpha-Beta Barrel
3.20.20	TIM Barrel
3.20.20.70	Aldolase class I	Gene3D
3.20.20.70.4
3.20.20.70.4.1
3.20.20.70.4.1.1
3.20.20.70.4.1.1.1
3.20.20.70.4.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 3b4uA00

Domain	Start PDB Residue	Stop PDB Residue
3b4uA00	4	290

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (12 entries)

There are 12 matching structural neighberhood comparisons for CATH ID 3.20.20.70.4.1.1.1.1 (SIMAX score < 5)

Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
3daqA00	87.45	Dihydrodipicolinate synthase [EC:4.2.1.52]Dihydrodipicolinate synthaseStaphylococcus aureus subsp. aureus MRSA252Lysine biosynthesisMetabolic pathways	3.20.20.70	289	25	94	2.12	2.24
1w3iA00	86.72	2-keto-3-deoxy gluconate aldolaseSulfolobus solfataricus	3.20.20.70	293	18	93	2.13	2.29
3lerC00	86.60	Dihydrodipicolinate synthase [EC:4.2.1.52]Dihydrodipicolinate synthaseCampylobacter jejuniLysine biosynthesisMetabolic pathways	3.20.20.70	289	23	93	2.09	2.23
1xxxB00	86.14	Metabolic pathwaysLysine biosynthesisDihydrodipicolinate synthase [EC:4.2.1.52]Dihydrodipicolinate synthaseMycobacterium tuberculosis	3.20.20.70	295	22	93	2.17	2.31
2rfgA00	85.17	Dihydrodipicolinate synthase [EC:4.2.1.52]Dihydrodipicolinate synthaseHahella chejuensis KCTC 2396Lysine biosynthesisMetabolic pathways	3.20.20.70	278	26	94	2.67	2.84
2wkjA00	84.65	Amino sugar and nucleotide sugar metabolismN-acetylneuraminate lyase [EC:4.1.3.3]N-acetylneuraminate lyase activityN-acetylneuraminate catabolic processEscherichia coli K-12	3.20.20.70	297	19	92	2.60	2.80
3e96A00	84.36	Dihydrodipicolinate synthase [EC:4.2.1.52]Bacillus clausii KSM-K16Dihydrodipicolinate synthaseMetabolic pathwaysLysine biosynthesis	3.20.20.70	296	19	92	2.38	2.57
2hmcA00	83.59	Metabolic pathwaysLysine biosynthesisDihydrodipicolinate synthase [EC:4.2.1.52]Agrobacterium tumefaciens str. C58Dihydrodipicolinate synthase	3.20.20.70	303	19	88	2.38	2.68
2r8wA00	80.16	Dihydrodipicolinate synthase [EC:4.2.1.52]Agrobacterium tumefaciens str. C58Dihydrodipicolinate synthaseMetabolic pathwaysLysine biosynthesis	3.20.20.70	287	19	90	3.24	3.56
3f4wA00	73.65	Pentose and glucuronate interconversionsMethane metabolismPutative hexulose 6 phosphate synthaseSalmonella enterica subsp. enterica serovar Typhimurium3-hexulose-6-phosphate synthase [EC:4.1.2.43]	3.20.20.70	211	10	67	3.15	4.69
1wbhB00	71.97	Arginine and proline metabolismGlyoxylate and dicarboxylate metabolismMetabolic pathwaysPentose and glucuronate interconversionsPentose phosphate pathway	3.20.20.70	214	7	62	3.01	4.84
2yw3E00	70.79	Arginine and proline metabolism2-dehydro-3-deoxyphosphogluconate aldolase / 4-hydroxy-2-oxoglutarate aldolase [EC:4.1.2.14 4.1.3.16]Glyoxylate and dicarboxylate metabolismMetabolic pathwaysThermus thermophilus HB8	3.20.20.70	198	12	60	3.02	4.99

[top]
Domain ATOM Sequence

>pdb|3b4uA00
KFGLSAALTTPFKTDGTVDIDAMIAHARRCLSNGCDSVTLFGTTGEGCSVGSRERQAILSSFIAAGIAPSRIVTGVLVDS
IEDAADQSAEALNAGARNILLAPPSYFKNVSDDGLFAWFSAVFSKIGKDARDILVYNIPSVTMVTLSVELVGRLKAAFPG
IVTGVKDSSGNWSHTERLLKEHGDLAILIGDERDLARGVRLGGQGAISGVANFLTQEVRAMAVDGKDDPRIVDLVVELLK
FPVTPAVKVLVSHTTGETIWSDVRAPLVAISPEDRRQIEGAFDALFR

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|3b4uA00
MTQKFGLSAALTTPFKTDGTVDIDAMIAHARRCLSNGCDSVTLFGTTGEGCSVGSRERQAILSSFIAAGIAPSRIVTGVL
VDSIEDAADQSAEALNAGARNILLAPPSYFKNVSDDGLFAWFSAVFSKIGKDARDILVYNIPSVTMVTLSVELVGRLKAA
FPGIVTGVKDSSGNWSHTERLLKEHGDLAILIGDERDLARGVRLGGQGAISGVANFLTQEVRAMAVDGKDDPRIVDLVVE
LLKFPVTPAVKVLVSHTTGETIWSDVRAPLVAISPEDRRQIEGAFDALFRRQAA

BLAST against CATH

[top]
Domain History Events (85)

Domain assigned by cuff on 05 Mar 2009 16:37

homology match

Domain assignment manual match h by cuff on 05 Mar 2009 16:35

same superfamily

Homcheck allotment by cuff on 26 Jan 2009 11:48

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 26 Jan 2009 11:48

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Oct 2008 23:50

Domain "3b4uA00" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Oct 2008 23:49

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3b4uA00

Flow stage update by auto on 19 Oct 2008 23:48

Retrieved PRC_PFAMCATH results for job ID SID0468793114467904 and results inserted.

Domain scan prc pfamcath by auto on 19 Oct 2008 23:48

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 17 results for 3b4uA00

Update comment by auto on 19 Oct 2008 18:05

PRC_PFAMCATH job SID0468793114467904 is not yet finished.

Flow stage update by auto on 19 Oct 2008 18:04

The entry "3b4uA00" has been submitted to the PRC_PFAMCATH webservice.

Prc pfamcath submit by auto on 19 Oct 2008 18:04

The entry "3b4uA00" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 19 Oct 2008 18:01

Retrieved SSAP results for job ID SID4445894862605984 and results inserted.

Domain scan ssap cath by auto on 19 Oct 2008 17:59

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 573 results for 3b4uA00

Update comment by auto on 16 Oct 2008 21:06

SSAP job SID4445894862605984 is not yet finished.

Ssap cath submit by auto on 16 Oct 2008 20:46

The entry "3b4uA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 20:46

The entry "3b4uA00" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 20:45

Retrieved PRC results for job ID SID8679651779671392 and inserted them into the database.

Domain scan prc cath by auto on 16 Oct 2008 20:45

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 10 results for 3b4uA00

Update comment by auto on 16 Oct 2008 11:44

PRC job SID8679651779671392 is not yet finished.

Prc cath submit by auto on 16 Oct 2008 11:43

The entry "3b4uA00" has been submitted to the PRC webservice.

Flow stage update by auto on 16 Oct 2008 11:43

The entry "3b4uA00" has been submitted to the PRC webservice.

Flow stage update by auto on 16 Oct 2008 09:03

Giving up on PRC job SID3317099241938392 because submission time of Fri Oct 10 06:11:55 2008 is more than 518400 seconds older than current time (Thu Oct 16 09:03:39 2008).

Update comment by auto on 10 Oct 2008 06:13

PRC job SID3317099241938392 is not yet finished.

Prc cath submit by auto on 10 Oct 2008 06:11

The entry "3b4uA00" has been submitted to the PRC webservice.

Flow stage update by auto on 10 Oct 2008 06:11

The entry "3b4uA00" has been submitted to the PRC webservice.

Flow stage update by auto on 10 Oct 2008 06:10

Retrieved HMM(SAM) results for job ID SID5999892605446544 and inserted them into the database.

Domain scan sam cath by auto on 10 Oct 2008 06:09

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 8 results for 3b4uA00