CATH Domain: 3b4nA02

3b4nA02

PDB 3b4n, Chain A, Domain 2

CATH Code	Level Description	Links
2	Mainly Beta
2.160	3 Solenoid
2.160.20	Pectate Lyase C-like
2.160.20.10	Single-stranded right-handed beta-helix, Pectin lyase-like	Gene3D
2.160.20.10.16
2.160.20.10.16.1
2.160.20.10.16.1.1
2.160.20.10.16.1.1.1
2.160.20.10.16.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 3b4nA02

Domain	Start PDB Residue	Stop PDB Residue
3b4nA01	20	107
3b4nA02	119	344

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 2.160.20.10.16.1.1.1.1 (SIMAX score < 5)

Match Depth	Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
	1ee6A00	84.84	Pectate lyaseBacillus sp.	2.160.20.10	197	31	82	2.39	2.89

[top]
Domain ATOM Sequence

>pdb|3b4nA02
SECKPGATFENRTVDCGGVTIGTSCPNDSDKQKPLIILKNATVKNLRISASGGADGIHCDSGNCTIENVIWEDICEDAAT
NNGKTMTIVGGIAHNAKDGYGGKPDKVLQHNSKNSTTVVKGNFTLTGEHGKLWRSCGDCSNNGGPRFLTVTSATVNGTID
SIAGVNRNYGDVATISGLKIKNYKEGKPPVCEEFKGVVKGQGSTEKYGEKWDTTNCKVSRSGVSKL

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|3b4nA02
SECKPGATFENRTVDCGGVTIGTSCPNDSDKQKPLIILKNATVKNLRISASGGADGIHCDSGNCTIENVIWEDICEDAAT
NNGKTMTIVGGIAHNAKDGYGGKPDKVLQHNSKNSTTVVKGNFTLTGEHGKLWRSCGDCSNNGGPRFLTVTSATVNGTID
SIAGVNRNYGDVATISGLKIKNYKEGKPPVCEEFKGVVKGQGSTEKYGEKWDTTNCKVSRSGVSKL

BLAST against CATH

[top]
Domain History Events (84)

Domain assigned by cuff on 26 Jan 2009 13:49

same superfamily

Domain assignment manual match h by cuff on 26 Jan 2009 13:47

homology match

Homcheck allotment by cuff on 23 Jan 2009 15:10

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 23 Jan 2009 15:10

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 19 Oct 2008 06:05

Domain "3b4nA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 19 Oct 2008 06:05

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 3b4nA02

Flow stage update by auto on 19 Oct 2008 06:04

Retrieved PRC_PFAMCATH results for job ID SID4174825046670150 and results inserted.

Domain scan prc pfamcath by auto on 19 Oct 2008 06:03

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 1 results for 3b4nA02

Flow stage update by auto on 18 Oct 2008 21:46

The entry "3b4nA02" has been submitted to the PRC_PFAMCATH webservice.

Update comment by auto on 18 Oct 2008 21:46

PRC_PFAMCATH job SID4174825046670150 is not yet finished.

Prc pfamcath submit by auto on 18 Oct 2008 21:46

The entry "3b4nA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 18 Oct 2008 21:43

Retrieved SSAP results for job ID SID6198407479590816 and results inserted.

Domain scan ssap cath by auto on 18 Oct 2008 21:42

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 52 results for 3b4nA02

Update comment by auto on 16 Oct 2008 21:06

SSAP job SID6198407479590816 is not yet finished.

Ssap cath submit by auto on 16 Oct 2008 20:46

The entry "3b4nA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 20:46

The entry "3b4nA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 20:45

Retrieved PRC results for job ID SID8706905810278272 and inserted them into the database.

Domain scan prc cath by auto on 16 Oct 2008 20:44

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 3b4nA02

Update comment by auto on 16 Oct 2008 11:44

PRC job SID8706905810278272 is not yet finished.

Flow stage update by auto on 16 Oct 2008 11:43

The entry "3b4nA02" has been submitted to the PRC webservice.

Prc cath submit by auto on 16 Oct 2008 11:43

The entry "3b4nA02" has been submitted to the PRC webservice.

Flow stage update by auto on 16 Oct 2008 09:03

Giving up on PRC job SID3739937031403040 because submission time of Fri Oct 10 06:11:35 2008 is more than 518400 seconds older than current time (Thu Oct 16 09:03:28 2008).

Update comment by auto on 10 Oct 2008 06:12

PRC job SID3739937031403040 is not yet finished.

Prc cath submit by auto on 10 Oct 2008 06:11

The entry "3b4nA02" has been submitted to the PRC webservice.

Flow stage update by auto on 10 Oct 2008 06:11

The entry "3b4nA02" has been submitted to the PRC webservice.

Flow stage update by auto on 10 Oct 2008 06:09

Retrieved HMM(SAM) results for job ID SID0025766853988816 and inserted them into the database.

Domain scan sam cath by auto on 10 Oct 2008 06:08

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 3b4nA02