CATH Domain: 3b2yA00 XML data for domain: 3b2yA00

Molscript image for 3b2yA00
3b2yA00
PDB coordinates for domain 3b2yA00

PDB 3b2y, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.630 Aminopeptidase
3.40.630.10 Zn peptidases Gene3D
3.40.630.10.10
3.40.630.10.10.1
3.40.630.10.10.1.1
3.40.630.10.10.1.1.1
3.40.630.10.10.1.1.1.1

[top]
Segment boundaries for domain 3b2yA00

Chopping figure for domain 3b2yA00
DomainStart PDB ResidueStop PDB Residue
3b2yA00 2 273

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.40.630.10.10.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1obrA00 76.94 Carboxypeptidase TThermoactinomyces vulgaris 3.40.630.10 323 10 70 3.46 4.90
1jqgA02 76.68 Carboxypeptidase AHelicoverpa armigera 3.40.630.10 309 13 72 3.38 4.64
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|3b2yA00
TSRSPFESFVWQSEIFNCQSNDIDAFYAQLAEEVNRLGLKKNTLGSVDSFAINLYQSASQRSDLPSLLISSGFHGEEAAG
PWGLHFLRGLQPALFERVNLSLLPLVNPTGFKAGHRFNRFGENPNRGFTLHTSLEGKLLLEHAQLLCAASRDGILTCHED
VLNETYVYSFEPTQTPGRFSLGLRDALGQYFKLAKFIDECPVTDGVIFNHFDTSFEAFLVRSGAKLAACSETPGQEDFDR
RVQANSAAGQFIAHCAPI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|3b2yA00
GXTSRSPFESFVWQSEIFNCQSNDIDAFYAQLAEEVNRLGLKKNTLGSVDSFAINLYQSASQRSDLPSLLISSGFHGEEA
AGPWGXLHFLRGLQPALFERVNLSLLPLVNPTGFKAGHRFNRFGENPNRGFTLENGKPTPNEHTSLEGKLLLEHAQLLCA
ASRDGILTCHEDVLXNETYVYSFEPTQTPGRFSLGLRDALGQYFKLAKDGFIDECPVTDGVIFNHFDTSFEAFLVRSGAK
LAACSETPGQEDFDRRVQANSAAXGQFIAHCAPIL
BLAST against CATH

[top]
Domain History Events (11)

Domain assigned by auto on 08 Jan 2009 13:58

Assigning to "3.40.630.10" based on similarity with "3b2yB00"

Flow stage update by auto on 08 Jan 2009 13:38

No in_process hits for Domain "3b2yA00" ready to be processed

Update comment by auto on 08 Jan 2009 13:16

Domain "3b2yA00" hits Domain "3b2yB00" (98.5454545454545% over 100%) which is currently in process

Update comment by auto on 08 Jan 2009 12:54

Domain "3b2yA00" hits Domain "2qvpC00" (64.7272727272727% over 99.6363636363636%) which is currently in process

Update comment by auto on 08 Jan 2009 12:28

Domain "3b2yA00" hits Domain "2qvpB00" (64.7272727272727% over 99.6363636363636%) which is currently in process

Update comment by auto on 24 Sep 2008 17:16

Domain "3b2yA00" hits Domain "2qvpA00" (64.7272727272727% over 99.6363636363636%) which is currently in process

Flow stage update by auto on 24 Sep 2008 17:14

Domain "3b2yA00" hits Domain "2qvpA00" (64.7272727272727% over 99.6363636363636%) which is currently in process

Flow stage update by auto on 24 Sep 2008 17:14

NW result present for Domain "3b2yA00"

Flow stage update by auto on 23 Sep 2008 08:17

All required files are present for Domain "3b2yA00"

Flow stage update by auto on 22 Sep 2008 15:12

Beginning processing for Domain "3b2yA00"

Insertion by auto on 22 Sep 2008 14:15

Final ChopClose added based on similarity with "2qvpA"