CATH Domain: 2zzzA02 XML data for domain: 2zzzA02

Molscript image for 2zzzA02
2zzzA02
PDB coordinates for domain 2zzzA02

PDB 2zzz, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.63 Guanylate Kinase phosphate binding domain
3.30.63.10 Guanylate Kinase phosphate binding domain Gene3D
3.30.63.10.3
3.30.63.10.3.1
3.30.63.10.3.1.1
3.30.63.10.3.1.1.2
3.30.63.10.3.1.1.2.1

[top]
Segment boundaries for domain 2zzzA02

Chopping figure for domain 2zzzA02
DomainStart PDB ResidueStop PDB Residue
2zzzA01 1 32
2zzzA01 93 186
2zzzA02 33 92

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2zzzA02
VSSTTRTPRAGEVNGKDYNFVSVDEFKSMIKNNEFIDWAQFSGNYYGSTVASVKQVSKSG
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2zzzA02
VSSTTRTPRAGEVNGKDYNFVSVDEFKSMIKNNEFIDWAQFSGNYYGSTVASVKQVSKSG
BLAST against CATH

[top]
Domain History Events (9)

Domain assigned by auto on 15 Mar 2009 12:22

Assigning to "3.30.63.10" based on similarity with "2zzzC02"

Flow stage update by auto on 15 Mar 2009 12:20

No in_process hits for Domain "2zzzA02" ready to be processed

Update comment by auto on 15 Mar 2009 11:47

Domain "2zzzA02" hits Domain "2zzzC02" (100% over 100%) which is currently in process

Update comment by auto on 15 Mar 2009 08:14

Domain "2zzzA02" hits Domain "2zzyA02" (98.3333333333333% over 100%) which is currently in process

Flow stage update by auto on 15 Mar 2009 07:28

Domain "2zzzA02" hits Domain "2zzyA02" (98.3333333333333% over 100%) which is currently in process

Flow stage update by auto on 15 Mar 2009 07:28

NW result present for Domain "2zzzA02"

Flow stage update by auto on 14 Mar 2009 14:16

All required files are present for Domain "2zzzA02"

Flow stage update by auto on 13 Mar 2009 14:47

Beginning processing for Domain "2zzzA02"

Insertion by auto on 13 Mar 2009 14:17

Final ChopClose added based on similarity with "2zzzB"