CATH Domain: 2zu1A01 XML data for domain: 2zu1A01

Molscript image for 2zu1A01
2zu1A01
PDB coordinates for domain 2zu1A01

PDB 2zu1, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
2 Mainly Beta
2.40 Beta Barrel
2.40.10 Thrombin, subunit H
2.40.10.10 Trypsin-like serine proteases Gene3D
2.40.10.10.16
2.40.10.10.16.1
2.40.10.10.16.1.1
2.40.10.10.16.1.1.1
2.40.10.10.16.1.1.1.1

[top]
Segment boundaries for domain 2zu1A01

Chopping figure for domain 2zu1A01
DomainStart PDB ResidueStop PDB Residue
2zu1A01 1 14
2zu1A01 84 180
2zu1A02 15 83

Structural Neighbourhood (10 entries)

There are 10 matching structural neighberhood comparisons for CATH ID 2.40.10.10.16.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 10 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2j92A02 85.74 Foot-and-mouth disease virus (strain A10-61)Genome polyprotein 2.40.10.10 109 15 85 1.85 2.16
2halA02 84.34 Human hepatitis A virus Hu/Australia/HM175/1976Genome polyprotein 2.40.10.10 103 16 76 2.00 2.61
2hrvA02 82.74 Genome polyproteinHuman rhinovirus 2 2.40.10.10 95 17 80 2.77 3.45
2qa9E02 81.54 Streptomyces griseusStreptogrisin-B 2.40.10.10 94 19 79 3.58 4.52
1y8tB02 81.54 Two-component systemPutative serine protease PepD [EC:3.4.21.-]PROBABLE SERINE PROTEASE PEPD (SERINE PROTEINASE) (MTB32B)Mycobacterium tuberculosis 2.40.10.10 111 9 82 2.86 3.45
2qf3B02 80.72 Protease degSProtein bindingSerine protease DegS [EC:3.4.21.-]Escherichia coli K-12 2.40.10.10 103 10 79 2.91 3.67
1arbA01 79.14 Achromobacter lyticusProtease 1 2.40.10.10 122 12 78 3.61 4.59
1lcyA02 77.76 Serine-type endopeptidase activityHtrA serine peptidase 2 [EC:3.4.21.108]Endoplasmic reticulum membraneParkinson's diseaseNucleus 2.40.10.10 84 13 72 3.01 4.18
2o8mA02 77.67 Genome polyproteinHepatitis C virus subtype 1a 2.40.10.10 87 12 64 2.73 4.21
1befA02 74.91 2.40.10.10 85 12 59 2.58 4.34
[1]
Displaying entries 1 to 10 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2zu1A01
GPAFEFAVAMMKRNRDIRGFLAKEEVEVNEAVLAINTSKFPNMYIPVGQVTEYGFLNLGGTPTKRMLMYNFPTRAGQAGG
VLMSTGKVLGIHVGGNGHQGFSAALLKHYFN
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2zu1A01
GPAFEFAVAMMKRNRDIRGFLAKEEVEVNEAVLAINTSKFPNMYIPVGQVTEYGFLNLGGTPTKRMLMYNFPTRAGQAGG
VLMSTGKVLGIHVGGNGHQGFSAALLKHYFNDEQ
BLAST against CATH

[top]
Domain History Events (13)

Domain assigned by auto on 20 Jan 2009 21:26

Assigning to "2.40.10.10" based on similarity with "2zu1B01"

Flow stage update by auto on 20 Jan 2009 21:26

No in_process hits for Domain "2zu1A01" ready to be processed

Update comment by auto on 20 Jan 2009 21:24

Domain "2zu1A01" hits Domain "2zu1B01" (100% over 100%) which is currently in process

Update comment by auto on 20 Jan 2009 21:20

Domain "2zu1A01" hits Domain "2zu3A01" (99.1228070175439% over 100%) which is currently in process

Update comment by auto on 20 Jan 2009 21:12

Domain "2zu1A01" hits Domain "2ztzA01" (99.1228070175439% over 100%) which is currently in process

Update comment by auto on 20 Jan 2009 21:09

Domain "2zu1A01" hits Domain "2ztzB01" (99.1228070175439% over 100%) which is currently in process

Update comment by auto on 20 Jan 2009 21:03

Domain "2zu1A01" hits Domain "2ztxA01" (99.1228070175439% over 100%) which is currently in process

Update comment by auto on 20 Jan 2009 20:52

Domain "2zu1A01" hits Domain "2ztyA01" (99.1228070175439% over 100%) which is currently in process

Flow stage update by auto on 20 Jan 2009 20:38

Domain "2zu1A01" hits Domain "2ztyA01" (99.1228070175439% over 100%) which is currently in process

Flow stage update by auto on 20 Jan 2009 20:38

NW result present for Domain "2zu1A01"

Flow stage update by auto on 20 Jan 2009 10:29

All required files are present for Domain "2zu1A01"

Flow stage update by auto on 19 Jan 2009 15:51

Beginning processing for Domain "2zu1A01"

Insertion by auto on 19 Jan 2009 14:22

Final ChopClose added based on similarity with "2zu1B"