CATH Domain: 2zmfA00 XML data for domain: 2zmfA00

Molscript image for 2zmfA00
2zmfA00
PDB coordinates for domain 2zmfA00

PDB 2zmf, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.450 Beta-Lactamase
3.30.450.40 Gene3D
3.30.450.40.8
3.30.450.40.8.1
3.30.450.40.8.1.1
3.30.450.40.8.1.1.2
3.30.450.40.8.1.1.2.1

[top]
Segment boundaries for domain 2zmfA00

Chopping figure for domain 2zmfA00
DomainStart PDB ResidueStop PDB Residue
2zmfA00 246 422

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 3.30.450.40.8.1.1.2.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1mc0A01 81.62 Mus musculusCGMP-dependent 3',5'-cyclic phosphodiesterase 3.30.450.40 158 18 90 3.97 4.39
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2zmfA00
QTELNDFLLDVSKTYFDNIVAIDSLLEHIIYAKNLVNADRCALFQVDHKNKELYSDLFDIGEEKEGKPVFKKTKEIRFSI
EKGIAGQVARTGEVLNIPDAYADPRFNREVDLYTGYTTRNILCPIVSRGSVIGVVQVNKISGSAFSKTDENNFKFAVFCA
LALHCANYHRIR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2zmfA00
GSSGSSGQTELNDFLLDVSKTYFDNIVAIDSLLEHIXIYAKNLVNADRCALFQVDHKNKELYSDLFDIGEEKEGKPVFKK
TKEIRFSIEKGIAGQVARTGEVLNIPDAYADPRFNREVDLYTGYTTRNILCXPIVSRGSVIGVVQXVNKISGSAFSKTDE
NNFKXFAVFCALALHCANXYHRIRHSECI
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 13 Dec 2008 23:47

Assigning to "3.30.450.40" based on similarity with "2e4sA00"

Flow stage update by auto on 13 Dec 2008 23:18

No in_process hits for Domain "2zmfA00" ready to be processed

Update comment by auto on 13 Dec 2008 20:18

Domain "2zmfA00" hits Domain "2zmfB00" (97.3544973544974% over 100%) which is currently in process

Flow stage update by auto on 13 Dec 2008 20:15

Domain "2zmfA00" hits Domain "2zmfB00" (97.3544973544974% over 100%) which is currently in process

Flow stage update by auto on 13 Dec 2008 20:14

NW result present for Domain "2zmfA00"

Flow stage update by auto on 10 Dec 2008 14:16

All required files are present for Domain "2zmfA00"

Flow stage update by auto on 10 Dec 2008 14:14

Beginning processing for Domain "2zmfA00"

Insertion by auto on 08 Dec 2008 16:41

Final ChopClose added based on similarity with "2e4sA"