CATH Domain: 2zfzF00 XML data for domain: 2zfzF00

Molscript image for 2zfzF00
2zfzF00
PDB coordinates for domain 2zfzF00

PDB 2zfz, Chain F, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1360 Gyrase A; domain 2
3.30.1360.40 Gene3D
3.30.1360.40.1
3.30.1360.40.1.1
3.30.1360.40.1.1.1
3.30.1360.40.1.1.1.1
3.30.1360.40.1.1.1.1.1

[top]
Segment boundaries for domain 2zfzF00

Chopping figure for domain 2zfzF00
DomainStart PDB ResidueStop PDB Residue
2zfzF00 95 170

Structural Neighbourhood (14 entries)

There are 14 matching structural neighberhood comparisons for CATH ID 3.30.1360.40.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 14 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1b4bA00 92.86 Geobacillus stearothermophilusArginine repressor 3.30.1360.40 71 35 93 1.50 1.61
1xxaC00 90.60 Transcriptional regulator of arginine metabolismArginine repressorEscherichia coli K-12Plasmid recombination 3.30.1360.40 73 31 93 2.03 2.17
3bp8C00 83.49 Amino sugar and nucleotide sugar metabolismPhosphotransferase system (PTS)Glycolysis / GluconeogenesisPTS system glucose-specific EIICB componentPTS system, glucose-specific IIB component [EC:2.7.1.69] 3.30.1360.60 75 8 92 3.09 3.35
1wqgA02 83.18 Ribosome recycling factorMycobacterium tuberculosisRibosome-recycling factor 3.30.1360.40 75 14 76 2.84 3.72
3bp3A00 82.82 Amino sugar and nucleotide sugar metabolismPhosphotransferase system (PTS)Glycolysis / GluconeogenesisPTS system glucose-specific EIICB componentPTS system, glucose-specific IIB component [EC:2.7.1.69] 3.30.1360.60 79 6 87 3.07 3.51
2phcB01 82.51 Pyrococcus horikoshiiPutative uncharacterized protein PH0987 3.30.1360.40 83 10 78 2.43 3.10
2qifA00 79.06 Bacillus subtilisCopper chaperone copZ 3.30.70.100 69 7 75 3.72 4.96
2kt2A00 78.89 Mercuric reductasePseudomonas aeruginosaMercuric reductase [EC:1.16.1.1] 3.30.70.100 69 13 75 3.30 4.40
3cjkB00 78.53 Cu2+-exporting ATPase [EC:3.6.3.4]Copper-dependent protein bindingCopper-transporting ATPase 1Cellular copper ion homeostasisTrans-Golgi network 3.30.70.100 75 5 71 2.83 3.98
1in0A01 78.31 Hypothetical proteinHaemophilus influenzaeUPF0234 protein HI_1034 3.30.70.860 70 5 73 2.89 3.92
2g9oA00 78.16 Cu2+-exporting ATPase [EC:3.6.3.4]Copper-dependent protein bindingCopper-transporting ATPase 1Trans-Golgi networkCellular copper ion homeostasis 3.30.70.100 77 7 71 3.43 4.80
1osdA00 78.15 Hypothetical periplasmic mercuric ion binding proteinCupriavidus metallidurans CH34 3.30.70.100 72 8 72 3.42 4.73
1vjqA00 76.42 3.30.70.340 71 2 73 3.64 4.94
1sqgA03 75.89 Ribosomal RNA small subunit methyltransferase B [EC:2.1.1.-]Ribosomal RNA small subunit methyltransferase BRRNA (cytosine-C5-)-methyltransferase activityRRNA base methylationEscherichia coli K-12 3.30.70.1170 58 8 60 2.99 4.94
[1]
Displaying entries 1 to 14 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2zfzF00
DRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2zfzF00
GGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR
BLAST against CATH

[top]
Domain History Events (17)

Domain assigned by auto on 26 Nov 2008 14:55

Assigning to "3.30.1360.40" based on similarity with "3bueB00"

Flow stage update by auto on 26 Nov 2008 14:54

No in_process hits for Domain "2zfzF00" ready to be processed

Update comment by auto on 26 Nov 2008 14:52

Domain "2zfzF00" hits Domain "2zfzA00" (100% over 100%) which is currently in process

Update comment by auto on 26 Nov 2008 14:50

Domain "2zfzF00" hits Domain "2zfzC00" (100% over 100%) which is currently in process

Update comment by auto on 26 Nov 2008 14:48

Domain "2zfzF00" hits Domain "2zfzD00" (100% over 100%) which is currently in process

Update comment by auto on 26 Nov 2008 14:46

Domain "2zfzF00" hits Domain "2zfzB00" (100% over 100%) which is currently in process

Update comment by auto on 26 Nov 2008 14:43

Domain "2zfzF00" hits Domain "3bueE00" (100% over 100%) which is currently in process

Update comment by auto on 26 Nov 2008 14:41

Domain "2zfzF00" hits Domain "3bueF00" (100% over 100%) which is currently in process

Update comment by auto on 26 Nov 2008 14:39

Domain "2zfzF00" hits Domain "3bueC00" (100% over 100%) which is currently in process

Update comment by auto on 26 Nov 2008 14:36

Domain "2zfzF00" hits Domain "3bueD00" (100% over 100%) which is currently in process

Update comment by auto on 26 Nov 2008 14:23

Domain "2zfzF00" hits Domain "3bueB00" (100% over 100%) which is currently in process

Update comment by auto on 26 Nov 2008 11:09

Domain "2zfzF00" hits Domain "3bueA00" (100% over 100%) which is currently in process

Flow stage update by auto on 26 Nov 2008 11:07

Domain "2zfzF00" hits Domain "3bueA00" (100% over 100%) which is currently in process

Flow stage update by auto on 26 Nov 2008 11:07

NW result present for Domain "2zfzF00"

Flow stage update by auto on 20 Nov 2008 11:08

All required files are present for Domain "2zfzF00"

Flow stage update by auto on 19 Nov 2008 17:59

Beginning processing for Domain "2zfzF00"

Insertion by auto on 19 Nov 2008 17:34

Final ChopClose added based on similarity with "2zfzA"