CATH Domain: 2zd1B01 XML data for domain: 2zd1B01

Molscript image for 2zd1B01
2zd1B01
PDB coordinates for domain 2zd1B01

PDB 2zd1, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.10 Roll
3.10.10 HIV Type 1 Reverse Transcriptase; Chain A, domain 1
3.10.10.10 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 Gene3D
3.10.10.10.2
3.10.10.10.2.1
3.10.10.10.2.1.1
3.10.10.10.2.1.1.1
3.10.10.10.2.1.1.1.1

[top]
Segment boundaries for domain 2zd1B01

Chopping figure for domain 2zd1B01
DomainStart PDB ResidueStop PDB Residue
2zd1B01 9 98
2zd1B01 124 164
2zd1B02 99 123
2zd1B02 165 233
2zd1B03 234 319
2zd1B04 320 427

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2zd1B01
PVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFW
EVQLGIPHPAFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSM
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2zd1B01
PVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFW
EVQLGIPHPAFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSM
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 25 Feb 2008 14:18

Assigning to "3.10.10.10" based on similarity with "1bqmB01"

Flow stage update by auto on 25 Feb 2008 14:05

No in_process hits for Domain "2zd1B01" ready to be processed

Flow stage update by auto on 25 Feb 2008 14:05

NW result present for Domain "2zd1B01"

Flow stage update by auto on 24 Feb 2008 08:43

All required files are present for Domain "2zd1B01"

Flow stage update by auto on 23 Feb 2008 12:17

Beginning processing for Domain "2zd1B01"

Insertion by auto on 23 Feb 2008 08:41

Final ChopClose added based on similarity with "1r0aB"