CATH Domain: 2zd1A05 XML data for domain: 2zd1A05

Molscript image for 2zd1A05
2zd1A05
PDB coordinates for domain 2zd1A05

PDB 2zd1, Chain A, Domain 5

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.420 Nucleotidyltransferase; domain 5
3.30.420.10 Gene3D
3.30.420.10.13
3.30.420.10.13.1
3.30.420.10.13.1.1
3.30.420.10.13.1.1.1
3.30.420.10.13.1.1.1.1

[top]
Segment boundaries for domain 2zd1A05

Chopping figure for domain 2zd1A05
DomainStart PDB ResidueStop PDB Residue
2zd1A01 -1 90
2zd1A01 116 156
2zd1A02 91 115
2zd1A02 157 225
2zd1A03 226 319
2zd1A04 320 426
2zd1A05 427 552

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.420.10.13.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2rkiA05 96.32 HIV-1 M:B_HXB2RGag-Pol polyprotein 3.30.420.10 126 91 98 0.59 0.60
1lwcA05 90.60 HIV-1 M:B_HXB2RGag-Pol polyprotein 3.30.420.10 91 97 72 0.55 0.76
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2zd1A05
YQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGII
QAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLV
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2zd1A05
YQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNKGRQKVVPLTNTTNQKTELQAIYLALQDSGLEVNIVTDSQYALGII
QAQPDKSESELVNQIIEQLIKKEKVYLAWVPAHKGIGGNEQVDKLVSAG
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 23 Feb 2008 23:31

Assigning to "3.30.420.10" based on similarity with "1t03A05"

Flow stage update by auto on 23 Feb 2008 23:12

No in_process hits for Domain "2zd1A05" ready to be processed

Flow stage update by auto on 23 Feb 2008 23:12

NW result present for Domain "2zd1A05"

Flow stage update by auto on 23 Feb 2008 12:18

All required files are present for Domain "2zd1A05"

Flow stage update by auto on 22 Feb 2008 21:20

Beginning processing for Domain "2zd1A05"

Insertion by auto on 22 Feb 2008 18:33

Final ChopClose added based on similarity with "1bqmA"