CATH Domain: 2zbxA00 XML data for domain: 2zbxA00

Molscript image for 2zbxA00
2zbxA00
PDB coordinates for domain 2zbxA00

PDB 2zbx, Chain A, Domain 0

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.10 Orthogonal Bundle
1.10.630 Cytochrome p450
1.10.630.10 Cytochrome p450 Gene3D
1.10.630.10.6
1.10.630.10.6.1
1.10.630.10.6.1.1
1.10.630.10.6.1.1.1
1.10.630.10.6.1.1.1.1

[top]
Segment boundaries for domain 2zbxA00

Chopping figure for domain 2zbxA00
DomainStart PDB ResidueStop PDB Residue
2zbxA00 8 410

Structural Neighbourhood (11 entries)

There are 11 matching structural neighberhood comparisons for CATH ID 1.10.630.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 11 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1odoA00 86.94 Streptomyces coelicolorPutative cytochrome P450 1.10.630.10 395 30 96 2.43 2.53
1s1fA00 86.66 Biflaviolin synthase [EC:1.14.21.7]Streptomyces coelicolorPutative cytochrome P450 1.10.630.10 397 32 98 3.01 3.06
1t2bA00 86.23 Citrobacter braakiiP450cin 1.10.630.10 397 20 95 2.48 2.58
2z3tA00 85.90 Cytochrome P450Streptomyces sp. TP-A0274 1.10.630.10 385 28 94 3.55 3.77
1io7A00 84.99 Sulfolobus acidocaldariusCytochrome P450 119[EC:1.14.14.-] 1.10.630.10 366 25 88 4.38 4.97
1lfkA00 84.61 Amycolatopsis orientalisCytochrome P450 165B3 1.10.630.10 375 35 93 3.47 3.72
1q5dA00 84.50 Epothilone biosynthetic processCytochrome P450 167A1Sorangium cellulosum 1.10.630.10 401 23 95 3.01 3.15
1cptA00 84.19 Pseudomonas sp.Cytochrome P450-terp 1.10.630.10 412 23 93 3.08 3.29
1n97A00 81.58 Thermus thermophilus HB27Cytochrome P450 1.10.630.10 385 17 88 3.24 3.65
1izoA00 80.71 Bacillus subtilisLimonene and pinene degradationNaphthalene and anthracene degradationGamma-Hexachlorocyclohexane degradationCytochrome P450 152A1 1.10.630.10 411 15 92 3.47 3.76
3czhA00 78.71 Vitamin D 25-hydroxylaseHomo sapiensCytochrome P450, family 2, subfamily R 1.10.630.10 465 15 81 3.65 4.47
[1]
Displaying entries 1 to 11 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2zbxA00
PQTTDAPAFPSNRSCPYQLPDGYAQLRDTPGPLHRVTLYDGRQAWVVTKHEAARKLLGDPRLSSNRTDDNFPATSPRFES
PQAFIGLDPPEHGTRRRMTISEFTVKRIKGMRPEVEEVVHGFLDEMLAAGPTADLVSQFALPVPSMVICRLLGVPYADHE
FFQDASKRLVQSTDAQSALTARNDLAGYLDGLITQFQTEPGAGLVGALVADQLANGEIDREELISTAMLLLIAGHETTAS
MTSLSVITLLDHPEQYAALRADRSLVPGAVEELLRYLAIADIAGGRVATADIEVEGQLIRAGEGVIVVNSIANRDGTVYE
DPDALDIHRSARHHLAFGFGVHQCLGQNLARLELEVILNALMDRVPTLRLAVPVEQLVLRPGTTIQGVNELPVTWHHHH
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2zbxA00
MTDTATTPQTTDAPAFPSNRSCPYQLPDGYAQLRDTPGPLHRVTLYDGRQAWVVTKHEAARKLLGDPRLSSNRTDDNFPA
TSPRFEAVRESPQAFIGLDPPEHGTRRRMTISEFTVKRIKGMRPEVEEVVHGFLDEMLAAGPTADLVSQFALPVPSMVIC
RLLGVPYADHEFFQDASKRLVQSTDAQSALTARNDLAGYLDGLITQFQTEPGAGLVGALVADQLANGEIDREELISTAML
LLIAGHETTASMTSLSVITLLDHPEQYAALRADRSLVPGAVEELLRYLAIADIAGGRVATADIEVEGQLIRAGEGVIVVN
SIANRDGTVYEDPDALDIHRSARHHLAFGFGVHQCLGQNLARLELEVILNALMDRVPTLRLAVPVEQLVLRPGTTIQGVN
ELPVTWHHHHHH
BLAST against CATH

[top]
Domain History Events (9)

Domain assigned by auto on 12 Apr 2008 20:38

Assigning to "1.10.630.10" based on similarity with "2zbyA00"

Flow stage update by auto on 12 Apr 2008 20:38

No in_process hits for Domain "2zbxA00" ready to be processed

Update comment by auto on 12 Apr 2008 20:31

Domain "2zbxA00" hits Domain "2zbzA00" (99.7572815533981% over 100%) which is currently in process

Update comment by auto on 12 Apr 2008 20:23

Domain "2zbxA00" hits Domain "2zbyA00" (99.7572815533981% over 100%) which is currently in process

Flow stage update by auto on 12 Apr 2008 20:08

Domain "2zbxA00" hits Domain "2zbyA00" (99.7572815533981% over 100%) which is currently in process

Flow stage update by auto on 12 Apr 2008 20:08

NW result present for Domain "2zbxA00"

Flow stage update by auto on 12 Apr 2008 08:09

All required files are present for Domain "2zbxA00"

Flow stage update by auto on 11 Apr 2008 11:48

Beginning processing for Domain "2zbxA00"

Insertion by auto on 11 Apr 2008 11:11

Final ChopClose added based on similarity with "2zbyA"