CATH Domain: 2zbwA01 XML data for domain: 2zbwA01

Molscript image for 2zbwA01
2zbwA01
PDB coordinates for domain 2zbwA01

PDB 2zbw, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.50 3-Layer(bba) Sandwich
3.50.50 FAD/NAD(P)-binding domain
3.50.50.60 Gene3D
3.50.50.60.16
3.50.50.60.16.1
3.50.50.60.16.1.1
3.50.50.60.16.1.1.1
3.50.50.60.16.1.1.1.1

[top]
Segment boundaries for domain 2zbwA01

Chopping figure for domain 2zbwA01
DomainStart PDB ResidueStop PDB Residue
2zbwA01 3 125
2zbwA01 249 335
2zbwA02 126 248

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 3.50.50.60.16.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1trbA01 87.27 Pyrimidine metabolismThioredoxin reductase (NADPH) [EC:1.8.1.9]Thioredoxin reductaseProtein bindingEscherichia coli K-12 3.50.50.60 187 26 85 2.46 2.89
3fbsB01 85.79 Agrobacterium tumefaciens str. C58Oxidoreductase 3.50.50.60 188 20 86 3.31 3.85
1sezA01 80.99 Nicotiana tabacumProtoporphyrinogen oxidase, mitochondrial 3.50.50.60 177 15 71 3.01 4.23
2gqfA01 80.97 Haemophilus influenzaeUncharacterized protein HI_0933 3.50.50.60 244 14 72 2.50 3.45
2i0zA01 80.09 NAD(FAD)-utilizing dehydrogenasesBacillus cereus ATCC 14579 3.50.50.60 260 17 70 2.79 3.99
2iidA02 79.65 Calloselasma rhodostomaL-amino-acid oxidase 3.50.50.60 148 15 66 2.54 3.83
3kkjA01 79.57 Pseudomonas syringae pv. tomatoAmine oxidase, flavin-containing protein 3.50.50.60 150 18 71 3.03 4.26
3g3eA01 77.57 PeroxisomeArginine and proline metabolismD-amino-acid oxidase [EC:1.4.3.3]Glycine, serine and threonine metabolismD-amino-acid oxidase activity 3.40.50.720 199 11 74 3.58 4.80
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2zbwA01
ADHTDVLIVGAGPTGLFAGFYVGRGLSFRFVDPLPEPGGQLTALYPEKYIYDVAGFPKVYAKDLVKGLVEQVAPFNPVYS
LGERAETLEREGDLFKVTTSQGNAYTAKAVIIAAGVGAFEPRGYITKLGPLANWGLALEKNKIKVDTTATSIPGVYACGD
IVTYPGKLPLIVLGFGEAAIAANHAAAYANPALKVNPGHSSEKAAPGT
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2zbwA01
XAADHTDVLIVGAGPTGLFAGFYVGXRGLSFRFVDPLPEPGGQLTALYPEKYIYDVAGFPKVYAKDLVKGLVEQVAPFNP
VYSLGERAETLEREGDLFKVTTSQGNAYTAKAVIIAAGVGAFEPRGYITKLGPLANWGLALEKNKIKVDTTXATSIPGVY
ACGDIVTYPGKLPLIVLGFGEAAIAANHAAAYANPALKVNPGHSSEKAAPGT
BLAST against CATH

[top]
Domain History Events (46)

Domain assigned by cuff on 05 Feb 2009 14:17

same superfamily

Domain assignment manual match h by cuff on 05 Feb 2009 14:15

homology match

Homcheck allotment by cuff on 05 Feb 2009 14:14

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 05 Feb 2009 14:14

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 28 Oct 2008 19:14

Domain "2zbwA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 28 Oct 2008 19:14

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2zbwA01

Flow stage update by auto on 28 Oct 2008 18:43

Retrieved PRC_PFAMCATH results for job ID SID3123663159908032 and results inserted.

Domain scan prc pfamcath by auto on 28 Oct 2008 18:42

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 3905 results for 2zbwA01

Update comment by auto on 25 Oct 2008 18:05

PRC_PFAMCATH job SID3123663159908032 is not yet finished.

Prc pfamcath submit by auto on 25 Oct 2008 18:04

The entry "2zbwA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 25 Oct 2008 18:04

The entry "2zbwA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 25 Oct 2008 17:56

Retrieved SSAP results for job ID SID7863114351187520 and results inserted.

Domain scan ssap cath by auto on 25 Oct 2008 17:53

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 1276 results for 2zbwA01

Update comment by auto on 23 Oct 2008 18:40

SSAP job SID7863114351187520 is not yet finished.

Ssap cath submit by auto on 23 Oct 2008 18:21

The entry "2zbwA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Oct 2008 18:21

The entry "2zbwA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 23 Oct 2008 17:53

Retrieved PRC results for job ID SID4440796482949440 and inserted them into the database.

Domain scan prc cath by auto on 23 Oct 2008 17:52

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 119 results for 2zbwA01

Update comment by auto on 23 Oct 2008 10:09

PRC job SID4440796482949440 is not yet finished.

Flow stage update by auto on 23 Oct 2008 10:05

The entry "2zbwA01" has been submitted to the PRC webservice.

Prc cath submit by auto on 23 Oct 2008 10:05

The entry "2zbwA01" has been submitted to the PRC webservice.

Flow stage update by auto on 23 Oct 2008 09:49

Retrieved HMM(SAM) results for job ID SID5488371243631712 and inserted them into the database.

Domain scan sam cath by auto on 23 Oct 2008 09:49

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 55 results for 2zbwA01

Update comment by auto on 22 Oct 2008 20:52

HMM(SAM) job SID5488371243631712 is not yet finished.

Sam cath submit by auto on 22 Oct 2008 20:50

The entry "2zbwA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Oct 2008 20:50

The entry "2zbwA01" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 22 Oct 2008 20:35

Retrieved "2zbwA01" CATHEDRAL results for job ID SID5360065221326464 and inserted them into the database.

Domain scan cathedral cath by auto on 22 Oct 2008 20:34

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 167 results for 2zbwA01

Update comment by auto on 22 Oct 2008 14:41

"2zbwA01" CATHEDRAL job SID5360065221326464 is not yet finished.

Flow stage update by auto on 22 Oct 2008 14:33

The entry "2zbwA01" has been submitted to the CATHEDRAL webservice.

Cathedral cath submit by auto on 22 Oct 2008 14:33

The entry "2zbwA01" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 22 Oct 2008 14:19

ScanList with 12259 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2zbwA01.scanlist" for "2zbwA01"

Write scan list by auto on 22 Oct 2008 14:19

Writing ScanList containing 12259 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2zbwA01.scanlist" for domain "2zbwA01"

Update comment by auto on 22 Oct 2008 11:51

Waiting for 14 new domains (example : 3dgvA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Oct 2008 09:11

Waiting for 42 new domains (example : 3cb5B01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Oct 2008 06:02

Waiting for 73 new domains (example : 3bjeA01) to be processed so that they can be scanned against too.

Update comment by auto on 22 Oct 2008 01:58

Waiting for 121 new domains (example : 3bgaA05) to be processed so that they can be scanned against too.

Update comment by auto on 21 Oct 2008 20:35

Waiting for 174 new domains (example : 3beeB00) to be processed so that they can be scanned against too.

Update comment by auto on 21 Oct 2008 18:34

Waiting for 225 new domains (example : 3b8sB01) to be processed so that they can be scanned against too.

Update comment by auto on 21 Oct 2008 14:25

Waiting for 277 new domains (example : 2zbwA02) to be processed so that they can be scanned against too.

Flow stage update by auto on 21 Oct 2008 14:24

No satisfactory AssignClose result found.

Flow stage update by auto on 21 Oct 2008 14:07

No in_process hits for Domain "2zbwA01" ready to be processed

Flow stage update by auto on 21 Oct 2008 14:07

NW result present for Domain "2zbwA01"

Flow stage update by auto on 21 Oct 2008 08:34

All required files are present for Domain "2zbwA01"

Flow stage update by auto on 20 Oct 2008 18:49

Beginning processing for Domain "2zbwA01"

Insertion by cuff on 20 Oct 2008 16:24

nice chopping