Domain assigned by cuff on 23 Jan 2009 14:26
homology match
CATH Domain: 2zbkA02
2zbkA02
PDB 2zbk, Chain A, Domain 2
Segment boundaries for domain 2zbkA02
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2zbkA01 | 10 | 158 |
| 2zbkA02 | 159 | 389 |
Structural Neighbourhood (0 entries)
Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.
Domain ATOM Sequence
>pdb|2zbkA02 EKGKVVGNLRIRSGNDVIDLSKTGHGAYAIEPTPDLIDFIDVDAEFVLVVEKDAVFQQLHRAGFWKQYKSILITSAGQPD RATRRFVRRLNEELKLPVYILTDADPYGWYIFSVFRIGSISERLATPDAKFLGVSMGDIFGNSRKKPYLSEAERKNYIIK AKDADIKRAEEIKNYEWFKTKAWQEEINTFLQRKAKLEIEAMASKGLKFLAFQYIPEKITNKDYIA
Domain History Events (46)
Domain assignment manual match h by cuff on 23 Jan 2009 14:24
same superfamily
Homcheck allotment by cuff on 23 Jan 2009 14:18
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by cuff on 23 Jan 2009 14:18
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Flow stage update by auto on 28 Oct 2008 19:13
Domain "2zbkA02" SCOP scan with no results - no SCOP mapping
Domain scan scop cath by auto on 28 Oct 2008 19:12
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2zbkA02
Flow stage update by auto on 28 Oct 2008 18:41
Retrieved PRC_PFAMCATH results for job ID SID7354864809136237 and results inserted.
Domain scan prc pfamcath by auto on 28 Oct 2008 18:40
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 0 results for 2zbkA02
Update comment by auto on 25 Oct 2008 06:41
PRC_PFAMCATH job SID7354864809136237 is not yet finished.
Flow stage update by auto on 25 Oct 2008 06:40
The entry "2zbkA02" has been submitted to the PRC_PFAMCATH webservice.
Prc pfamcath submit by auto on 25 Oct 2008 06:40
The entry "2zbkA02" has been submitted to the PRC_PFAMCATH webservice.
Flow stage update by auto on 25 Oct 2008 06:23
Retrieved SSAP results for job ID SID8914368291689920 and results inserted.
Domain scan ssap cath by auto on 25 Oct 2008 06:20
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 678 results for 2zbkA02
Update comment by auto on 23 Oct 2008 18:39
SSAP job SID8914368291689920 is not yet finished.
Flow stage update by auto on 23 Oct 2008 18:19
The entry "2zbkA02" has been submitted to the SSAP webservice.
Ssap cath submit by auto on 23 Oct 2008 18:19
The entry "2zbkA02" has been submitted to the SSAP webservice.
Flow stage update by auto on 23 Oct 2008 17:47
Retrieved PRC results for job ID SID0491126041230652 and inserted them into the database.
Domain scan prc cath by auto on 23 Oct 2008 17:46
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 2 results for 2zbkA02
Update comment by auto on 23 Oct 2008 06:33
PRC job SID0491126041230652 is not yet finished.
Prc cath submit by auto on 23 Oct 2008 06:31
The entry "2zbkA02" has been submitted to the PRC webservice.
Flow stage update by auto on 23 Oct 2008 06:31
The entry "2zbkA02" has been submitted to the PRC webservice.
Flow stage update by auto on 23 Oct 2008 06:21
Retrieved HMM(SAM) results for job ID SID8703998796200104 and inserted them into the database.
Domain scan sam cath by auto on 23 Oct 2008 06:21
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 2 results for 2zbkA02
Update comment by auto on 22 Oct 2008 17:45
HMM(SAM) job SID8703998796200104 is not yet finished.
Sam cath submit by auto on 22 Oct 2008 17:43
The entry "2zbkA02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 22 Oct 2008 17:43
The entry "2zbkA02" has been submitted to the HMM (SAM) webservice.
Flow stage update by auto on 22 Oct 2008 17:33
Retrieved "2zbkA02" CATHEDRAL results for job ID SID1568426623701728 and inserted them into the database.
Domain scan cathedral cath by auto on 22 Oct 2008 17:31
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 496 results for 2zbkA02
Update comment by auto on 22 Oct 2008 14:40
"2zbkA02" CATHEDRAL job SID1568426623701728 is not yet finished.
Flow stage update by auto on 22 Oct 2008 14:32
The entry "2zbkA02" has been submitted to the CATHEDRAL webservice.
Cathedral cath submit by auto on 22 Oct 2008 14:32
The entry "2zbkA02" has been submitted to the CATHEDRAL webservice.
Flow stage update by auto on 22 Oct 2008 14:17
ScanList with 12259 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2zbkA02.scanlist" for "2zbkA02"
Write scan list by auto on 22 Oct 2008 14:17
Writing ScanList containing 12259 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2zbkA02.scanlist" for domain "2zbkA02"
Update comment by auto on 22 Oct 2008 11:51
Waiting for 14 new domains (example : 3dgvA01) to be processed so that they can be scanned against too.
Update comment by auto on 22 Oct 2008 09:11
Waiting for 42 new domains (example : 3cb5B01) to be processed so that they can be scanned against too.
Update comment by auto on 22 Oct 2008 06:02
Waiting for 73 new domains (example : 3bjeA01) to be processed so that they can be scanned against too.
Update comment by auto on 22 Oct 2008 01:58
Waiting for 121 new domains (example : 3bgaA05) to be processed so that they can be scanned against too.
Update comment by auto on 21 Oct 2008 20:35
Waiting for 174 new domains (example : 3beeB00) to be processed so that they can be scanned against too.
Update comment by auto on 21 Oct 2008 18:33
Waiting for 225 new domains (example : 3b8sB01) to be processed so that they can be scanned against too.
Update comment by auto on 21 Oct 2008 14:25
Waiting for 277 new domains (example : 2zbwA02) to be processed so that they can be scanned against too.
Flow stage update by auto on 21 Oct 2008 14:24
No satisfactory AssignClose result found.
Flow stage update by auto on 21 Oct 2008 14:07
No in_process hits for Domain "2zbkA02" ready to be processed
Flow stage update by auto on 21 Oct 2008 14:07
NW result present for Domain "2zbkA02"
Flow stage update by auto on 21 Oct 2008 08:34
All required files are present for Domain "2zbkA02"
Flow stage update by auto on 20 Oct 2008 18:49
Beginning processing for Domain "2zbkA02"
Insertion by cuff on 20 Oct 2008 16:52
nice chopping
