Domain assigned by cuff on 21 Jan 2009 13:08
homology match
| CATH Code | Level Description | Links |
|---|---|---|
3
| Alpha Beta | |
3.20
| Alpha-Beta Barrel | |
3.20.20
| TIM Barrel | |
3.20.20.120
| Enolase superfamily | Gene3D |
3.20.20.120.9
| ||
3.20.20.120.9.1
| ||
3.20.20.120.9.1.1
| ||
3.20.20.120.9.1.1.1
| ||
3.20.20.120.9.1.1.1.1
|
| Domain | Start PDB Residue | Stop PDB Residue |
|---|---|---|
| 2zadA01 | 2 | 115 |
| 2zadA02 | 116 | 345 |
There are 29 matching structural neighberhood comparisons for CATH ID 3.20.20.120.9.1.1.1.1 (SIMAX score < 5)
>pdb|2zadA02 TQVCYLLGGKRDEIETDKTVGIDTVENRVKEAKKIFEEGFRVIKIKVGENLKEDIEAVEEIAKVTRGAKYIVDANGYTQK EAVEFARAVYQKGIDIAVYEQPVRREDIEGLKFVRFHSPFPVAADESARTKFDVRLVKEEAVDYVNIKLKSGISDALAIV EIAESSGLKLIGCGESSLGINQSVHFALGTGAFEFHDLDSHLLKEEVFRGKFIQDGPRRVKDQ
homology match
same superfamily
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.
Domain "2zadA02" SCOP scan with no results - no SCOP mapping
Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2zadA02
Retrieved PRC_PFAMCATH results for job ID SID0236346281232384 and results inserted.
Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 131 results for 2zadA02
The entry "2zadA02" has been submitted to the PRC_PFAMCATH webservice.
The entry "2zadA02" has been submitted to the PRC_PFAMCATH webservice.
Retrieved SSAP results for job ID SID6982101311357938 and results inserted.
Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 997 results for 2zadA02
SSAP job SID6982101311357938 is not yet finished.
The entry "2zadA02" has been submitted to the SSAP webservice.
The entry "2zadA02" has been submitted to the SSAP webservice.
Giving up on SSAP job SID4465091186388008 because submission time of Tue Oct 28 12:15:55 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:34:52 2008).
SSAP job SID4465091186388008 is not yet finished.
The entry "2zadA02" has been submitted to the SSAP webservice.
The entry "2zadA02" has been submitted to the SSAP webservice.
Giving up on SSAP job SID4164391020330112 because submission time of Wed Oct 22 09:29:00 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:59:16 2008).
SSAP job SID4164391020330112 is not yet finished.
The entry "2zadA02" has been submitted to the SSAP webservice.
The entry "2zadA02" has been submitted to the SSAP webservice.
Giving up on SSAP job SID0719024781074272 because submission time of Thu Oct 16 06:06:20 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:25:23 2008).
SSAP job SID0719024781074272 is not yet finished.
The entry "2zadA02" has been submitted to the SSAP webservice.
The entry "2zadA02" has been submitted to the SSAP webservice.
Giving up on SSAP job SID3050161115357954 because submission time of Fri Oct 10 03:09:27 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:35:58 2008).
SSAP job SID3050161115357954 is not yet finished.
The entry "2zadA02" has been submitted to the SSAP webservice.
The entry "2zadA02" has been submitted to the SSAP webservice.
Retrieved PRC results for job ID SID0993778118361264 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 41 results for 2zadA02
PRC job SID0993778118361264 is not yet finished.
The entry "2zadA02" has been submitted to the PRC webservice.
The entry "2zadA02" has been submitted to the PRC webservice.
Retrieved HMM(SAM) results for job ID SID4972459836190224 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 38 results for 2zadA02
HMM(SAM) job SID4972459836190224 is not yet finished.
The entry "2zadA02" has been submitted to the HMM (SAM) webservice.
The entry "2zadA02" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2zadA02" HMM(SAM) results for job "SID9577837319173120"
HMM(SAM) job SID9577837319173120 is not yet finished.
The entry "2zadA02" has been submitted to the HMM (SAM) webservice.
The entry "2zadA02" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2zadA02" HMM(SAM) results for job "SID6588276713464348"
HMM(SAM) job SID6588276713464348 is not yet finished.
The entry "2zadA02" has been submitted to the HMM (SAM) webservice.
The entry "2zadA02" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2zadA02" HMM(SAM) results for job "SID3404651837942346"
HMM(SAM) job SID3404651837942346 is not yet finished.
The entry "2zadA02" has been submitted to the HMM (SAM) webservice.
The entry "2zadA02" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2zadA02" HMM(SAM) results for job "SID2655373953268144"
HMM(SAM) job SID2655373953268144 is not yet finished.
The entry "2zadA02" has been submitted to the HMM (SAM) webservice.
The entry "2zadA02" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2zadA02" HMM(SAM) results for job "SID3476279888427962"
HMM(SAM) job SID3476279888427962 is not yet finished.
The entry "2zadA02" has been submitted to the HMM (SAM) webservice.
The entry "2zadA02" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2zadA02" HMM(SAM) results for job "SID0552816483355536"
HMM(SAM) job SID0552816483355536 is not yet finished.
The entry "2zadA02" has been submitted to the HMM (SAM) webservice.
The entry "2zadA02" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2zadA02" HMM(SAM) results for job "SID8712386877970624"
HMM(SAM) job SID8712386877970624 is not yet finished.
The entry "2zadA02" has been submitted to the HMM (SAM) webservice.
The entry "2zadA02" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2zadA02" HMM(SAM) results for job "SID4654821914014144"
HMM(SAM) job SID4654821914014144 is not yet finished.
The entry "2zadA02" has been submitted to the HMM (SAM) webservice.
The entry "2zadA02" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2zadA02" HMM(SAM) results for job "SID3781648347483976"
HMM(SAM) job SID3781648347483976 is not yet finished.
The entry "2zadA02" has been submitted to the HMM (SAM) webservice.
The entry "2zadA02" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2zadA02" HMM(SAM) results for job "SID9535325470618368"
HMM(SAM) job SID9535325470618368 is not yet finished.
The entry "2zadA02" has been submitted to the HMM (SAM) webservice.
The entry "2zadA02" has been submitted to the HMM (SAM) webservice.
Unable to retrieve "2zadA02" HMM(SAM) results for job "SID7716165715559889"
HMM(SAM) job SID7716165715559889 is not yet finished.
The entry "2zadA02" has been submitted to the HMM (SAM) webservice.
The entry "2zadA02" has been submitted to the HMM (SAM) webservice.
Retrieved "2zadA02" CATHEDRAL results for job ID SID7920308133432968 and inserted them into the database.
Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 142 results for 2zadA02
"2zadA02" CATHEDRAL job SID7920308133432968 is not yet finished.
The entry "2zadA02" has been submitted to the CATHEDRAL webservice.
The entry "2zadA02" has been submitted to the CATHEDRAL webservice.
ScanList with 12131 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2zadA02.scanlist" for "2zadA02"
Writing ScanList containing 12131 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2zadA02.scanlist" for domain "2zadA02"
Waiting for 4 new domains (example : 3cklA00) to be processed so that they can be scanned against too.
Waiting for 29 new domains (example : 3b8yB02) to be processed so that they can be scanned against too.
No satisfactory AssignClose result found.
No in_process hits for Domain "2zadA02" ready to be processed
NW result present for Domain "2zadA02"
All required files are present for Domain "2zadA02"
Beginning processing for Domain "2zadA02"
nice chopping