CATH Domain: 2zadA02 XML data for domain: 2zadA02

Molscript image for 2zadA02
2zadA02
PDB coordinates for domain 2zadA02

PDB 2zad, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.20 Alpha-Beta Barrel
3.20.20 TIM Barrel
3.20.20.120 Enolase superfamily Gene3D
3.20.20.120.9
3.20.20.120.9.1
3.20.20.120.9.1.1
3.20.20.120.9.1.1.1
3.20.20.120.9.1.1.1.1

Segment boundaries for domain 2zadA02

Chopping figure for domain 2zadA02
DomainStart PDB ResidueStop PDB Residue
2zadA01 2 115
2zadA02 116 345

Structural Neighbourhood (29 entries)

There are 29 matching structural neighberhood comparisons for CATH ID 3.20.20.120.9.1.1.1.1 (SIMAX score < 5)

Displaying entries 1 to 29 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1tkkA02 90.18 Bacillus subtilisL-Ala-D/L-Glu epimerase 3.20.20.120 244 36 90 1.17 1.29
2chrA02 86.60 Ralstonia eutropha JMP134Chloromuconate cycloisomeraseToluene and xylene degradationMuconate cycloisomerase [EC:5.5.1.1]Benzoate degradation via hydroxylation 3.20.20.120 202 21 86 1.64 1.91
2pgwA02 86.37 Sinorhizobium melilotiToluene and xylene degradationBenzoate degradation via hydroxylationMuconate cycloisomerase [EC:5.5.1.1]Mandelate racemase/muconate lactonizing enzyme family protein 3.20.20.120 215 22 92 2.19 2.36
2qdeA02 86.23 Aromatoleum aromaticum EbN1Mandelate racemase/muconate lactonizing enzyme family protein 3.20.20.120 239 25 90 2.28 2.51
2oqyA02 85.71 Muconate cycloisomeraseOceanobacillus iheyensis 3.20.20.120 226 18 92 2.34 2.52
1jpdX02 85.48 Racemase and epimerase activity, acting on amino acids and derivativesL-Ala-D/L-Glu epimeraseEscherichia coli K-12 3.20.20.120 207 25 88 2.23 2.51
2qddA02 85.12 Mandelate racemase/muconate lactonizing enzyme, putativeRoseovarius nubinhibens ISM 3.20.20.120 236 21 90 2.24 2.48
2qvhA02 85.08 Ubiquinone and other terpenoid-quinone biosynthesisThermobifida fusca YXO-succinylbenzoate-CoA synthaseO-succinylbenzoate synthase [EC:4.2.1.113]Metabolic pathways 3.20.20.120 224 23 91 2.66 2.89
3fv9A02 85.05 Mandelate racemase/muconate lactonizing enzyme, putativeRoseovarius nubinhibens ISM 3.20.20.120 243 22 89 2.22 2.49
2ovlA02 84.80 Toluene and xylene degradationStreptomyces coelicolorMandelate racemase [EC:5.1.2.2]Benzoate degradation via hydroxylationPutative racemase 3.20.20.120 223 20 93 2.46 2.64
2oqhA02 84.55 Putative isomeraseStreptomyces coelicolor 3.20.20.120 240 20 89 2.21 2.47
3cb3A02 84.26 Toluene and xylene degradationPolaromonas sp. JS666Mandelate racemase [EC:5.1.2.2]Mandelate racemase/muconate lactonizing enzymeBenzoate degradation via hydroxylation 3.20.20.120 233 22 91 2.91 3.18
2nqlA02 84.08 Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme 3.20.20.120 214 18 93 2.60 2.77
1mdlA02 84.07 Mandelate racemasePseudomonas putida 3.20.20.120 230 18 93 2.34 2.51
2oz8A02 83.76 Mesorhizobium lotiMll7089 protein 3.20.20.120 230 20 92 2.53 2.73
3cyjA02 83.48 Rubrobacter xylanophilus DSM 9941Mandelate racemase/muconate lactonizing enzyme-like proteinToluene and xylene degradationMandelate racemase [EC:5.1.2.2]Benzoate degradation via hydroxylation 3.20.20.120 235 21 90 2.53 2.79
3bjsA02 83.28 Polaromonas sp. JS666Mandelate racemase/muconate lactonizing enzyme 3.20.20.120 250 21 86 2.48 2.87
2pozH02 82.98 Putative dehydrataseMesorhizobium loti 3.20.20.120 246 18 88 2.54 2.88
2oztA02 82.54 Ubiquinone and other terpenoid-quinone biosynthesisThermosynechococcus elongatus BP-1O-succinylbenzoate synthase [EC:4.2.1.113]Tlr1174 proteinMetabolic pathways 3.20.20.120 201 14 86 2.60 3.01
3cawA02 82.26 Ubiquinone and other terpenoid-quinone biosynthesisO-succinylbenzoate synthase [EC:4.2.1.113]Bdellovibrio bacteriovorusMetabolic pathwaysPutative uncharacterized protein 3.20.20.120 225 17 91 3.19 3.50
1ec7A02 82.12 Ascorbate and aldarate metabolismD-glucarate catabolic processGlucarate dehydratase activityGlucarate dehydrataseGlucarate dehydratase [EC:4.2.1.40] 3.20.20.120 261 17 81 2.59 3.17
2hzgA02 81.88 Rhodobacter sphaeroides 2.4.1Mandelate racemase/muconate lactonizing enzyme/Enolase superfamily 3.20.20.120 248 12 88 2.97 3.35
1yeyB02 81.51 Xanthomonas campestris pv. campestrisRTS beta protein 3.20.20.120 243 20 81 2.50 3.05
1r6wA01 81.18 Ubiquinone and other terpenoid-quinone biosynthesisMetabolic pathwaysMenaquinone biosynthetic processO-succinylbenzoate synthaseHydro-lyase activity 3.20.20.120 198 22 85 2.97 3.49
2podB02 80.54 Mandelate racemase / muconate lactonizing enzymeBurkholderia pseudomallei 3.20.20.120 251 19 86 2.83 3.29
3go2A02 80.22 Burkholderia xenovorans LB400Putative uncharacterized protein 3.20.20.120 268 16 80 2.59 3.21
2qq6A02 80.19 Rubrobacter xylanophilus DSM 9941Mandelate racemase/muconate lactonizing enzyme-like protein 3.20.20.120 262 21 83 2.52 3.03
1tzzA02 79.80 Bradyrhizobium japonicumBll6730 protein 3.20.20.120 256 17 83 2.92 3.51
2pmqA02 79.08 Roseovarius sp. HTCC2601Mandelate racemase/muconate lactonizing enzyme 3.20.20.120 224 16 91 3.51 3.84
Displaying entries 1 to 29 (page 1 of 1)


Domain ATOM Sequence

>pdb|2zadA02
TQVCYLLGGKRDEIETDKTVGIDTVENRVKEAKKIFEEGFRVIKIKVGENLKEDIEAVEEIAKVTRGAKYIVDANGYTQK
EAVEFARAVYQKGIDIAVYEQPVRREDIEGLKFVRFHSPFPVAADESARTKFDVRLVKEEAVDYVNIKLKSGISDALAIV
EIAESSGLKLIGCGESSLGINQSVHFALGTGAFEFHDLDSHLLKEEVFRGKFIQDGPRRVKDQ    

Domain COMBS Sequence

>pdb|2zadA02
TQVCYLLGGKRDEIETDKTVGIDTVENRVKEAKKIFEEGFRVIKIKVGENLKEDIEAVEEIAKVTRGAKYIVDANXGYTQ
KEAVEFARAVYQKGIDIAVYEQPVRREDIEGLKFVRFHSPFPVAADESARTKFDVXRLVKEEAVDYVNIKLXKSGISDAL
AIVEIAESSGLKLXIGCXGESSLGINQSVHFALGTGAFEFHDLDSHLXLKEEVFRGKFIQDGPRXRVKDQ    

Domain History Events (100)

Domain assigned by cuff on 21 Jan 2009 13:08

homology match

Domain assignment manual match h by cuff on 21 Jan 2009 13:06

same superfamily

Homcheck allotment by cuff on 21 Jan 2009 13:05

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 21 Jan 2009 13:05

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 06 Nov 2008 12:10

Domain "2zadA02" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 06 Nov 2008 12:09

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2zadA02

Flow stage update by auto on 06 Nov 2008 12:00

Retrieved PRC_PFAMCATH results for job ID SID0236346281232384 and results inserted.

Domain scan prc pfamcath by auto on 06 Nov 2008 12:00

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 131 results for 2zadA02

Prc pfamcath submit by auto on 06 Nov 2008 11:56

The entry "2zadA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Nov 2008 11:56

The entry "2zadA02" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 06 Nov 2008 11:43

Retrieved SSAP results for job ID SID6982101311357938 and results inserted.

Domain scan ssap cath by auto on 06 Nov 2008 11:41

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 997 results for 2zadA02

Update comment by auto on 03 Nov 2008 17:50

SSAP job SID6982101311357938 is not yet finished.

Ssap cath submit by auto on 03 Nov 2008 17:38

The entry "2zadA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 17:38

The entry "2zadA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 14:34

Giving up on SSAP job SID4465091186388008 because submission time of Tue Oct 28 12:15:55 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:34:52 2008).

Update comment by auto on 28 Oct 2008 12:33

SSAP job SID4465091186388008 is not yet finished.

Ssap cath submit by auto on 28 Oct 2008 12:15

The entry "2zadA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 12:15

The entry "2zadA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 08:59

Giving up on SSAP job SID4164391020330112 because submission time of Wed Oct 22 09:29:00 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:59:16 2008).

Update comment by auto on 22 Oct 2008 09:44

SSAP job SID4164391020330112 is not yet finished.

Ssap cath submit by auto on 22 Oct 2008 09:29

The entry "2zadA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 09:29

The entry "2zadA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:25

Giving up on SSAP job SID0719024781074272 because submission time of Thu Oct 16 06:06:20 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:25:23 2008).

Update comment by auto on 16 Oct 2008 06:23

SSAP job SID0719024781074272 is not yet finished.

Flow stage update by auto on 16 Oct 2008 06:06

The entry "2zadA02" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 16 Oct 2008 06:06

The entry "2zadA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:35

Giving up on SSAP job SID3050161115357954 because submission time of Fri Oct 10 03:09:27 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:35:58 2008).

Update comment by auto on 10 Oct 2008 03:45

SSAP job SID3050161115357954 is not yet finished.

Ssap cath submit by auto on 10 Oct 2008 03:09

The entry "2zadA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 03:09

The entry "2zadA02" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 02:01

Retrieved PRC results for job ID SID0993778118361264 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 02:00

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 41 results for 2zadA02

Update comment by auto on 09 Oct 2008 06:49

PRC job SID0993778118361264 is not yet finished.

Flow stage update by auto on 09 Oct 2008 06:21

The entry "2zadA02" has been submitted to the PRC webservice.

Prc cath submit by auto on 09 Oct 2008 06:21

The entry "2zadA02" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Oct 2008 05:55

Retrieved HMM(SAM) results for job ID SID4972459836190224 and inserted them into the database.

Domain scan sam cath by auto on 09 Oct 2008 05:54

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 38 results for 2zadA02

Update comment by auto on 05 Oct 2008 20:54

HMM(SAM) job SID4972459836190224 is not yet finished.

Sam cath submit by auto on 05 Oct 2008 20:36

The entry "2zadA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 05 Oct 2008 20:36

The entry "2zadA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 05 Oct 2008 17:56

Unable to retrieve "2zadA02" HMM(SAM) results for job "SID9577837319173120"

Update comment by auto on 03 Oct 2008 03:57

HMM(SAM) job SID9577837319173120 is not yet finished.

Flow stage update by auto on 03 Oct 2008 03:33

The entry "2zadA02" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 03 Oct 2008 03:33

The entry "2zadA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 03 Oct 2008 00:39

Unable to retrieve "2zadA02" HMM(SAM) results for job "SID6588276713464348"

Update comment by auto on 02 Oct 2008 21:07

HMM(SAM) job SID6588276713464348 is not yet finished.

Sam cath submit by auto on 02 Oct 2008 20:44

The entry "2zadA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 20:44

The entry "2zadA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 18:27

Unable to retrieve "2zadA02" HMM(SAM) results for job "SID3404651837942346"

Update comment by auto on 02 Oct 2008 15:15

HMM(SAM) job SID3404651837942346 is not yet finished.

Flow stage update by auto on 02 Oct 2008 14:52

The entry "2zadA02" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 02 Oct 2008 14:52

The entry "2zadA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 02 Oct 2008 12:13

Unable to retrieve "2zadA02" HMM(SAM) results for job "SID2655373953268144"

Update comment by auto on 02 Oct 2008 03:50

HMM(SAM) job SID2655373953268144 is not yet finished.

Flow stage update by auto on 02 Oct 2008 03:18

The entry "2zadA02" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 02 Oct 2008 03:18

The entry "2zadA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 01 Oct 2008 21:06

Unable to retrieve "2zadA02" HMM(SAM) results for job "SID3476279888427962"

Update comment by auto on 27 Sep 2008 12:28

HMM(SAM) job SID3476279888427962 is not yet finished.

Sam cath submit by auto on 27 Sep 2008 12:19

The entry "2zadA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 27 Sep 2008 12:19

The entry "2zadA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 27 Sep 2008 09:10

Unable to retrieve "2zadA02" HMM(SAM) results for job "SID0552816483355536"

Update comment by auto on 26 Sep 2008 14:54

HMM(SAM) job SID0552816483355536 is not yet finished.

Sam cath submit by auto on 26 Sep 2008 14:44

The entry "2zadA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 14:44

The entry "2zadA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 12:28

Unable to retrieve "2zadA02" HMM(SAM) results for job "SID8712386877970624"

Update comment by auto on 26 Sep 2008 09:17

HMM(SAM) job SID8712386877970624 is not yet finished.

Sam cath submit by auto on 26 Sep 2008 09:06

The entry "2zadA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 09:06

The entry "2zadA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 06:39

Unable to retrieve "2zadA02" HMM(SAM) results for job "SID4654821914014144"

Update comment by auto on 26 Sep 2008 03:51

HMM(SAM) job SID4654821914014144 is not yet finished.

Sam cath submit by auto on 26 Sep 2008 03:38

The entry "2zadA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 03:38

The entry "2zadA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 26 Sep 2008 00:06

Unable to retrieve "2zadA02" HMM(SAM) results for job "SID3781648347483976"

Update comment by auto on 25 Sep 2008 20:52

HMM(SAM) job SID3781648347483976 is not yet finished.

Flow stage update by auto on 25 Sep 2008 20:45

The entry "2zadA02" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 25 Sep 2008 20:45

The entry "2zadA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 18:04

Unable to retrieve "2zadA02" HMM(SAM) results for job "SID9535325470618368"

Update comment by auto on 25 Sep 2008 14:59

HMM(SAM) job SID9535325470618368 is not yet finished.

Sam cath submit by auto on 25 Sep 2008 14:51

The entry "2zadA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 14:51

The entry "2zadA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 12:36

Unable to retrieve "2zadA02" HMM(SAM) results for job "SID7716165715559889"

Update comment by auto on 25 Sep 2008 09:48

HMM(SAM) job SID7716165715559889 is not yet finished.

Flow stage update by auto on 25 Sep 2008 09:41

The entry "2zadA02" has been submitted to the HMM (SAM) webservice.

Sam cath submit by auto on 25 Sep 2008 09:41

The entry "2zadA02" has been submitted to the HMM (SAM) webservice.

Flow stage update by auto on 25 Sep 2008 09:35

Retrieved "2zadA02" CATHEDRAL results for job ID SID7920308133432968 and inserted them into the database.

Domain scan cathedral cath by auto on 25 Sep 2008 09:34

Adding scan of type "DOMAIN_SCAN_CATHEDRAL_CATH" with 142 results for 2zadA02

Update comment by auto on 25 Sep 2008 02:01

"2zadA02" CATHEDRAL job SID7920308133432968 is not yet finished.

Cathedral cath submit by auto on 25 Sep 2008 00:12

The entry "2zadA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 25 Sep 2008 00:12

The entry "2zadA02" has been submitted to the CATHEDRAL webservice.

Flow stage update by auto on 24 Sep 2008 23:51

ScanList with 12131 domains written to "/cath/data/current/scanlists/cathdb_current.fletcher/2zadA02.scanlist" for "2zadA02"

Write scan list by auto on 24 Sep 2008 23:51

Writing ScanList containing 12131 domains to file "/cath/data/current/scanlists/cathdb_current.fletcher/2zadA02.scanlist" for domain "2zadA02"

Update comment by auto on 24 Sep 2008 21:15

Waiting for 4 new domains (example : 3cklA00) to be processed so that they can be scanned against too.

Update comment by auto on 24 Sep 2008 17:32

Waiting for 29 new domains (example : 3b8yB02) to be processed so that they can be scanned against too.

Flow stage update by auto on 24 Sep 2008 17:31

No satisfactory AssignClose result found.

Flow stage update by auto on 24 Sep 2008 17:14

No in_process hits for Domain "2zadA02" ready to be processed

Flow stage update by auto on 24 Sep 2008 17:14

NW result present for Domain "2zadA02"

Flow stage update by auto on 23 Sep 2008 08:17

All required files are present for Domain "2zadA02"

Flow stage update by auto on 22 Sep 2008 15:12

Beginning processing for Domain "2zadA02"

Insertion by cuff on 22 Sep 2008 13:30

nice chopping