CATH Domain: 2zadA01

2zadA01

PDB 2zad, Chain A, Domain 1

CATH Code	Level Description	Links
3	Alpha Beta
3.30	2-Layer Sandwich
3.30.390	Enolase-like; domain 1
3.30.390.10	Enolase-like, N-terminal domain	Gene3D
3.30.390.10.14
3.30.390.10.14.1
3.30.390.10.14.1.1
3.30.390.10.14.1.1.1
3.30.390.10.14.1.1.1.1

Structure
Sequence
History

[top]
Segment boundaries for domain 2zadA01

Domain	Start PDB Residue	Stop PDB Residue
2zadA01	2	115
2zadA02	116	345

What is a Structural Neighbour?

The term "structural neighbour" is used here to describe two CATH domains that share a degree of structural similarity. The SSAP algorithm is used to calculate this similarity and works by generating a structure-based pairwise alignment of the two domains then scoring this alignment using a RMSD score which has been normalised by the length of the larger domain divided by the number of aligned residues (SIMAX).

Structural Neighbourhood (18 entries)

There are 18 matching structural neighberhood comparisons for CATH ID 3.30.390.10.14.1.1.1.1 (SIMAX score < 5)

Match	SSAP score	Match Keywords	Match Superfamily	Length	Sequence Id	Overlap	RMSD	SIMAX
1tkkA01	90.38	Bacillus subtilisL-Ala-D/L-Glu epimerase	3.30.390.10	115	25	93	1.45	1.54
1nu5A01	88.75	Chloromuconate cycloisomerasePseudomonas sp. P51	3.30.390.10	116	22	92	2.10	2.28
3bjsA01	86.57	Polaromonas sp. JS666Mandelate racemase/muconate lactonizing enzyme	3.30.390.10	116	13	87	2.01	2.29
2ovlA01	86.41	Toluene and xylene degradationStreptomyces coelicolorMandelate racemase [EC:5.1.2.2]Benzoate degradation via hydroxylationPutative racemase	3.30.390.10	123	19	84	2.17	2.57
3go2A01	85.92	Burkholderia xenovorans LB400Putative uncharacterized protein	3.30.390.10	114	17	81	2.28	2.79
1rvkA01	84.72	Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme	3.30.390.10	115	17	86	2.98	3.43
2oqyA01	83.84	Muconate cycloisomeraseOceanobacillus iheyensis	3.30.390.10	142	15	71	2.11	2.97
1ec7C01	83.63	Ascorbate and aldarate metabolismD-glucarate catabolic processGlucarate dehydratase activityGlucarate dehydrataseGlucarate dehydratase [EC:4.2.1.40]	3.30.390.10	136	16	73	1.88	2.56
2qq6B01	83.60	Rubrobacter xylanophilus DSM 9941Mandelate racemase/muconate lactonizing enzyme-like protein	3.30.390.10	115	17	76	2.36	3.08
1jpdX01	83.17	Racemase and epimerase activity, acting on amino acids and derivativesL-Ala-D/L-Glu epimeraseEscherichia coli K-12	3.30.390.10	99	23	87	2.88	3.30
2oz8A01	82.45	Mesorhizobium lotiMll7089 protein	3.30.390.10	128	17	79	3.25	4.08
2qjjA01	81.73	Mandelate racemase/muconate lactonizing enzyme, N-terminal domain proteinStarvation sensing protein RspANovosphingobium aromaticivorans DSM 12444	3.30.390.10	140	20	65	2.04	3.10
2pgwA01	81.15	Sinorhizobium melilotiToluene and xylene degradationBenzoate degradation via hydroxylationMuconate cycloisomerase [EC:5.5.1.1]Mandelate racemase/muconate lactonizing enzyme family protein	3.30.390.10	147	15	69	2.38	3.43
2hzgB01	80.86	Rhodobacter sphaeroides 2.4.1Mandelate racemase/muconate lactonizing enzyme/Enolase superfamily	3.30.390.10	143	18	68	3.11	4.54
3cawA01	80.26	Ubiquinone and other terpenoid-quinone biosynthesisO-succinylbenzoate synthase [EC:4.2.1.113]Bdellovibrio bacteriovorusMetabolic pathwaysPutative uncharacterized protein	3.30.390.10	91	12	69	2.84	4.07
1kkoA01	79.88	3-methylaspartate ammonia-lyaseCitrobacter amalonaticus	3.30.390.10	163	17	65	2.73	4.20
2nqlA01	79.61	Agrobacterium tumefaciens str. C58Isomerase/lactonizing enzyme	3.30.390.10	162	18	63	2.64	4.15
1i4jA00	74.12	Ribosome50S ribosomal protein L22Large subunit ribosomal protein L22Thermus thermophilus	3.90.470.10	110	6	51	2.58	4.98

[top]
Domain ATOM Sequence

>pdb|2zadA01
SRIVNVKLSLKRYEYEKPFHITGSVSSESRNVEVEIVLESGVKGYGEASPSFRVNGERVEALLAIENAVREITGIDVRNY
ARIFEITDRLFGFPSLKAAVQFATLDALSQELG

BLAST against CATH

[top]
Domain COMBS Sequence

>pdb|2zadA01
XSRIVNVKLSLKRYEYEKPFHITGSVSSESRNVEVEIVLESGVKGYGEASPSFRVNGERVEALLAIENAVREXITGIDVR
NYARIFEITDRLFGFPSLKAAVQFATLDALSQELG

BLAST against CATH

[top]
Domain History Events (100)

Domain assigned by cuff on 21 Jan 2009 13:05

homology match

Domain assignment manual match h by cuff on 21 Jan 2009 13:04

same superfamily

Homcheck allotment by cuff on 21 Jan 2009 13:02

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by cuff on 21 Jan 2009 13:02

User 'cuff' has allocated a domain to themselves for HomChecking with comment : Grabbed this domain via HomCheck's "Get Me A Domain" button.

Flow stage update by auto on 05 Nov 2008 17:59

Domain "2zadA01" SCOP scan with no results - no SCOP mapping

Domain scan scop cath by auto on 05 Nov 2008 17:59

Adding scan of type "DOMAIN_SCAN_SCOP_CATH" with 0 results for 2zadA01

Flow stage update by auto on 05 Nov 2008 17:55

Retrieved PRC_PFAMCATH results for job ID SID3154931585690800 and results inserted.

Domain scan prc pfamcath by auto on 05 Nov 2008 17:54

Adding scan of type "DOMAIN_SCAN_PRC_PFAMCATH" with 34 results for 2zadA01

Update comment by auto on 05 Nov 2008 15:01

PRC_PFAMCATH job SID3154931585690800 is not yet finished.

Prc pfamcath submit by auto on 05 Nov 2008 14:55

The entry "2zadA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 05 Nov 2008 14:55

The entry "2zadA01" has been submitted to the PRC_PFAMCATH webservice.

Flow stage update by auto on 05 Nov 2008 14:38

Retrieved SSAP results for job ID SID5587849649988864 and results inserted.

Domain scan ssap cath by auto on 05 Nov 2008 14:32

Adding scan of type "DOMAIN_SCAN_SSAP_CATH" with 2720 results for 2zadA01

Update comment by auto on 03 Nov 2008 17:50

SSAP job SID5587849649988864 is not yet finished.

Flow stage update by auto on 03 Nov 2008 17:38

The entry "2zadA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 03 Nov 2008 17:38

The entry "2zadA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 03 Nov 2008 14:34

Giving up on SSAP job SID3412608292763680 because submission time of Tue Oct 28 12:15:48 2008 is more than 518400 seconds older than current time (Mon Nov 3 14:34:47 2008).

Update comment by auto on 28 Oct 2008 12:33

SSAP job SID3412608292763680 is not yet finished.

Ssap cath submit by auto on 28 Oct 2008 12:15

The entry "2zadA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 12:15

The entry "2zadA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 28 Oct 2008 08:59

Giving up on SSAP job SID2246812313670464 because submission time of Wed Oct 22 09:28:53 2008 is more than 518400 seconds older than current time (Tue Oct 28 08:59:11 2008).

Update comment by auto on 22 Oct 2008 09:44

SSAP job SID2246812313670464 is not yet finished.

Flow stage update by auto on 22 Oct 2008 09:28

The entry "2zadA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 22 Oct 2008 09:28

The entry "2zadA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 22 Oct 2008 06:25

Giving up on SSAP job SID8465352554964296 because submission time of Thu Oct 16 06:06:15 2008 is more than 518400 seconds older than current time (Wed Oct 22 06:25:16 2008).

Update comment by auto on 16 Oct 2008 06:23

SSAP job SID8465352554964296 is not yet finished.

Ssap cath submit by auto on 16 Oct 2008 06:06

The entry "2zadA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 06:06

The entry "2zadA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 16 Oct 2008 03:35

Giving up on SSAP job SID7723913051811423 because submission time of Fri Oct 10 03:09:17 2008 is more than 518400 seconds older than current time (Thu Oct 16 03:35:52 2008).

Update comment by auto on 10 Oct 2008 03:45

SSAP job SID7723913051811423 is not yet finished.

Flow stage update by auto on 10 Oct 2008 03:09

The entry "2zadA01" has been submitted to the SSAP webservice.

Ssap cath submit by auto on 10 Oct 2008 03:09

The entry "2zadA01" has been submitted to the SSAP webservice.

Flow stage update by auto on 10 Oct 2008 02:00

Retrieved PRC results for job ID SID3909665213843856 and inserted them into the database.

Domain scan prc cath by auto on 10 Oct 2008 01:59

Adding scan of type "DOMAIN_SCAN_PRC_CATH" with 31 results for 2zadA01

Update comment by auto on 09 Oct 2008 06:49

PRC job SID3909665213843856 is not yet finished.

Flow stage update by auto on 09 Oct 2008 06:20

The entry "2zadA01" has been submitted to the PRC webservice.

Prc cath submit by auto on 09 Oct 2008 06:20

The entry "2zadA01" has been submitted to the PRC webservice.

Flow stage update by auto on 09 Oct 2008 05:54

Retrieved HMM(SAM) results for job ID SID0299178886731208 and inserted them into the database.

Domain scan sam cath by auto on 09 Oct 2008 05:54

Adding scan of type "DOMAIN_SCAN_SAM_CATH" with 25 results for 2zadA01