CATH Domain: 2z8uB02 XML data for domain: 2z8uB02

Molscript image for 2z8uB02
2z8uB02
PDB coordinates for domain 2z8uB02

PDB 2z8u, Chain B, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.310 TATA-Binding Protein
3.30.310.10 TATA-Binding Protein Gene3D
3.30.310.10.3
3.30.310.10.3.1
3.30.310.10.3.1.1
3.30.310.10.3.1.1.1
3.30.310.10.3.1.1.1.1

[top]
Segment boundaries for domain 2z8uB02

Chopping figure for domain 2z8uB02
DomainStart PDB ResidueStop PDB Residue
2z8uB01 3 11
2z8uB01 99 177
2z8uB02 12 98

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 3.30.310.10.3.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
1harA02 79.44 Human immunodeficiency virus type 1 BH10Gag-Pol polyprotein 3.30.70.270 69 10 75 2.73 3.60
2g30A02 78.81 AP-2 complex subunit betaHomo sapiensProtein binding 3.30.310.10 116 9 62 2.54 4.04
1dloB02 78.05 Human immunodeficiency virus type 1 BH10Gag-Pol polyprotein 3.30.70.270 93 9 78 2.82 3.59
1p5dX04 77.96 Galactose metabolismAmino sugar and nucleotide sugar metabolismFructose and mannose metabolismMetabolic pathwaysStarch and sucrose metabolism 3.30.310.50 93 13 81 3.55 4.34
1m3qA01 76.81 Endonuclease activityN-glycosylase/DNA lyaseBase excision repairN-glycosylase/DNA lyase [EC:3.2.2.- 4.2.99.18]Homo sapiens 3.30.310.40 89 5 76 3.73 4.88
1ul7A00 76.52 Mus musculusMAP/microtubule affinity-regulating kinase 3 3.30.310.80 102 13 69 3.10 4.45
1konA03 75.35 UPF0082 protein yebCEscherichia coli K-12 3.30.70.980 75 12 67 3.23 4.76
1rwuA00 73.80 Hypothetical proteinUPF0250 protein ybeDEscherichia coli K-12 3.30.70.1460 87 9 71 3.22 4.52
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2z8uB02
VSTKIGDNIDLEEVAMILENAEYEPEQFPGLVCRLSVPKVALLIFRSGKVNCTGAKSKEEAEIAIKKIIKELKDAGIDVI
ENPEIKI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2z8uB02
VSTKIGDNIDLEEVAMILENAEYEPEQFPGLVCRLSVPKVALLIFRSGKVNCTGAKSKEEAEIAIKKIIKELKDAGIDVI
ENPEIKI
BLAST against CATH

[top]
Domain History Events (12)

Domain assigned by auto on 30 Aug 2008 17:48

Assigning to "3.30.310.10" based on similarity with "2z8uA02"

Flow stage update by auto on 30 Aug 2008 17:47

No in_process hits for Domain "2z8uB02" ready to be processed

Update comment by auto on 30 Aug 2008 17:45

Domain "2z8uB02" hits Domain "2z8uB01" (43.6781609195402% over 77.2277227722772%) which is currently in process

Update comment by auto on 30 Aug 2008 17:43

Domain "2z8uB02" hits Domain "2z8uA02" (100% over 100%) which is currently in process

Update comment by auto on 30 Aug 2008 17:40

Domain "2z8uB02" hits Domain "2z8uQ01" (43.6781609195402% over 77.2277227722772%) which is currently in process

Update comment by auto on 30 Aug 2008 17:33

Domain "2z8uB02" hits Domain "2z8uP02" (100% over 100%) which is currently in process

Update comment by auto on 30 Aug 2008 17:25

Domain "2z8uB02" hits Domain "2z8uA01" (43.6781609195402% over 77.2277227722772%) which is currently in process

Flow stage update by auto on 30 Aug 2008 17:08

Domain "2z8uB02" hits Domain "2z8uA01" (43.6781609195402% over 77.2277227722772%) which is currently in process

Flow stage update by auto on 30 Aug 2008 17:08

NW result present for Domain "2z8uB02"

Flow stage update by auto on 30 Aug 2008 08:14

All required files are present for Domain "2z8uB02"

Flow stage update by auto on 29 Aug 2008 11:45

Beginning processing for Domain "2z8uB02"

Insertion by auto on 29 Aug 2008 11:16

Final ChopClose added based on similarity with "2z8uA"