CATH Domain: 2z4uA02 XML data for domain: 2z4uA02

Molscript image for 2z4uA02
2z4uA02
PDB coordinates for domain 2z4uA02

PDB 2z4u, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
4 Few Secondary Structures
4.10 Irregular
4.10.470 Ricin (A Subunit), domain 2
4.10.470.10 Ricin (A Subunit), domain 2 Gene3D
4.10.470.10.2
4.10.470.10.2.1
4.10.470.10.2.1.1
4.10.470.10.2.1.1.1
4.10.470.10.2.1.1.1.1

[top]
Segment boundaries for domain 2z4uA02

Chopping figure for domain 2z4uA02
DomainStart PDB ResidueStop PDB Residue
2z4uA01 1 177
2z4uA02 178 258

Structural Neighbourhood (8 entries)

There are 8 matching structural neighberhood comparisons for CATH ID 4.10.470.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 8 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
3ktzA02 91.95 Ribosome-inactivating protein geloninGelonium multiflorum 4.10.470.10 83 37 97 2.79 2.86
1m2tA02 91.79 Beta-galactoside-specific lectin 1Viscum album 4.10.470.10 81 20 97 1.38 1.41
2vc4A02 90.82 Ricinus communisRicin 4.10.470.10 88 35 92 1.22 1.33
1abrA02 90.04 RRNA N-glycosylase activityAbrus precatoriusAbrin-aGalactose bindingNegative regulation of translation 4.10.470.10 85 25 95 1.70 1.78
3hisA02 89.47 Saponaria officinalisSaporin-L3 4.10.470.10 81 38 93 3.35 3.57
1hwmA02 89.38 Sambucus ebulusRibosome-inactivating protein 4.10.470.10 86 28 93 1.63 1.75
1rl0A02 88.48 Dianthus caryophyllusAntiviral protein DAP-30 4.10.470.10 74 32 88 1.84 2.07
1llnA02 87.44 Antiviral protein 2Phytolacca americana 4.10.470.10 81 24 92 2.27 2.45
[1]
Displaying entries 1 to 8 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2z4uA02
RFKYIENQVKTNFNRAFNPNPKVLSLEENWGKISLAIHNAKNGALTSPLELKNADDTKWIVLRVDEIKPDMGLLNYVSGT
C
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2z4uA02
RFKYIENQVKTNFNRAFNPNPKVLSLEENWGKISLAIHNAKNGALTSPLELKNADDTKWIVLRVDEIKPDMGLLNYVSGT
C
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 03 Mar 2008 20:18

Assigning to "4.10.470.10" based on similarity with "2qesA02"

Flow stage update by auto on 03 Mar 2008 20:05

No in_process hits for Domain "2z4uA02" ready to be processed

Flow stage update by auto on 03 Mar 2008 20:05

NW result present for Domain "2z4uA02"

Flow stage update by auto on 03 Mar 2008 08:08

All required files are present for Domain "2z4uA02"

Flow stage update by auto on 02 Mar 2008 20:39

Beginning processing for Domain "2z4uA02"

Insertion by auto on 02 Mar 2008 20:12

Final ChopClose added based on similarity with "2qesA"