CATH Domain: 2z4uA01 XML data for domain: 2z4uA01

Molscript image for 2z4uA01
2z4uA01
PDB coordinates for domain 2z4uA01

PDB 2z4u, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.40 3-Layer(aba) Sandwich
3.40.420 Ricin (A subunit); domain 1
3.40.420.10 Ricin (A subunit), domain 1 Gene3D
3.40.420.10.2
3.40.420.10.2.1
3.40.420.10.2.1.1
3.40.420.10.2.1.1.1
3.40.420.10.2.1.1.1.1

[top]
Segment boundaries for domain 2z4uA01

Chopping figure for domain 2z4uA01
DomainStart PDB ResidueStop PDB Residue
2z4uA01 1 177
2z4uA02 178 258

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.40.420.10.2.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2vc4A01 89.41 Ricinus communisRicin 3.40.420.10 175 22 95 1.91 2.00
3hisA01 89.26 Saponaria officinalisSaporin-L3 3.40.420.10 176 32 97 2.31 2.36
3ktzA01 88.16 Ribosome-inactivating protein geloninGelonium multiflorum 3.40.420.10 168 27 92 1.88 2.04
1abrA01 87.59 RRNA N-glycosylase activityAbrus precatoriusAbrin-aGalactose bindingNegative regulation of translation 3.40.420.10 166 27 91 1.76 1.92
1r4pA01 84.85 Pathogenic Escherichia coli infectionShiga toxin subunit AShiga-like toxin 2 subunit AEnterobacteria phage 933W 3.40.420.10 170 20 88 2.64 3.00
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2z4uA01
VNTITFDVGNATINKYATFMESLRNEAKDPTLKCYGIPMLPDSNLTPKYVLVKLQDASSKTITLMLRRNNLYVMGYSDLY
NGKCRYHIFNDISSTESTDVENTLCPNSNSREKKAINYNSQYSTLQNKAGVSSRSQVQLGIQILNSDIGKISGVSTFTDK
TEAEFLLVAIQMVSEAA
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2z4uA01
VNTITFDVGNATINKYATFMESLRNEAKDPTLKCYGIPMLPDSNLTPKYVLVKLQDASSKTITLMLRRNNLYVMGYSDLY
NGKCRYHIFNDISSTESTDVENTLCPNSNSREKKAINYNSQYSTLQNKAGVSSRSQVQLGIQILNSDIGKISGVSTFTDK
TEAEFLLVAIQMVSEAA
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 03 Mar 2008 20:18

Assigning to "3.40.420.10" based on similarity with "2qesA01"

Flow stage update by auto on 03 Mar 2008 20:05

No in_process hits for Domain "2z4uA01" ready to be processed

Flow stage update by auto on 03 Mar 2008 20:05

NW result present for Domain "2z4uA01"

Flow stage update by auto on 03 Mar 2008 08:08

All required files are present for Domain "2z4uA01"

Flow stage update by auto on 02 Mar 2008 20:39

Beginning processing for Domain "2z4uA01"

Insertion by auto on 02 Mar 2008 20:12

Final ChopClose added based on similarity with "2qesA"