CATH Domain: 2z26B00 XML data for domain: 2z26B00

Molscript image for 2z26B00
2z26B00
PDB coordinates for domain 2z26B00

PDB 2z26, Chain B, Domain 0

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.20 Alpha-Beta Barrel
3.20.20 TIM Barrel
3.20.20.140 Metal-dependent hydrolases Gene3D
3.20.20.140.4
3.20.20.140.4.1
3.20.20.140.4.1.1
3.20.20.140.4.1.1.1
3.20.20.140.4.1.1.1.1

[top]
Segment boundaries for domain 2z26B00

Chopping figure for domain 2z26B00
DomainStart PDB ResidueStop PDB Residue
2z26B00 4 346

Structural Neighbourhood (5 entries)

There are 5 matching structural neighberhood comparisons for CATH ID 3.20.20.140.4.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 5 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2gwnA02 82.97 Pyrimidine metabolismDihydroorotaseDihydroorotase [EC:3.5.2.3]Porphyromonas gingivalisMetabolic pathways 3.20.20.140 330 14 86 2.37 2.74
1gkrB02 81.80 L-hydantoinaseArthrobacter aurescens 3.20.20.140 320 13 83 2.13 2.56
3e74B02 81.60 Purine metabolismMetabolic pathwaysZinc ion bindingCobalt ion bindingEscherichia coli K-12 3.20.20.140 319 12 88 2.65 2.99
1kcxA02 77.81 Mus musculusDendriteDihydropyrimidinase-related protein 1Neuronal cell body 3.20.20.140 373 13 81 3.52 4.30
3cjpA00 74.53 Predicted amidohodrolase (Dihydroorotase family)Clostridium acetobutylicum 3.20.20.140 260 9 65 3.06 4.67
[1]
Displaying entries 1 to 5 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2z26B00
SQVLKIRRPDDWHLHLRDGDMLKTVVPYTSEIYGRAIVMPNLAPPVTTVEAAVAYRQRILDAVPAGHDFTPLMTCYLTDS
LDPNELERGFNEGVFTAALYPAGVTSVDAIMPVLERMEKIGMPLLVHGEVTHADIDIFDREARFIESVMEPLRQRLTALK
VVFEHITTKDAADYVRDGNERLAATITPQHLMFNRNHMLVGGVRPHLYCLPILKRNIHQQALRELVASGFNRVFLGTDSA
PHARHRKESSCGCAGCFNAPTALGSYATVFEEMNALQHFEAFCSVNGPQFYGLPVNDTFIELVREEQQVAESIALTDDTL
VPFLAGETVRWSVK
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2z26B00
TAPSQVLKIRRPDDWHLHLRDGDMLKTVVPYTSEIYGRAIVMPNLAPPVTTVEAAVAYRQRILDAVPAGHDFTPLMTCYL
TDSLDPNELERGFNEGVFTAAXLYPANATANSSHGVTSVDAIMPVLERMEKIGMPLLVHGEVTHADIDIFDREARFIESV
MEPLRQRLTALKVVFEHITTKDAADYVRDGNERLAATITPQHLMFNRNHMLVGGVRPHLYCLPILKRNIHQQALRELVAS
GFNRVFLGTDSAPHARHRKESSCGCAGCFNAPTALGSYATVFEEMNALQHFEAFCSVNGPQFYGLPVNDTFIELVREEQQ
VAESIALTDDTLVPFLAGETVRWSVKQ
BLAST against CATH

[top]
Domain History Events (17)

Domain assigned by auto on 02 Dec 2007 06:48

Assigning to "3.20.20.140" based on similarity with "2z26A00"

Flow stage update by auto on 02 Dec 2007 06:48

No in_process hits for Domain "2z26B00" ready to be processed

Update comment by auto on 02 Dec 2007 06:25

Domain "2z26B00" hits Domain "2z2bA00" (99.7032640949555% over 97.1181556195965%) which is currently in process

Update comment by auto on 02 Dec 2007 05:56

Domain "2z26B00" hits Domain "2z26A00" (99.7118155619597% over 100%) which is currently in process

Update comment by auto on 02 Dec 2007 05:27

Domain "2z26B00" hits Domain "2z27B00" (99.135446685879% over 100%) which is currently in process

Update comment by auto on 02 Dec 2007 05:03

Domain "2z26B00" hits Domain "2z25B00" (99.4236311239193% over 100%) which is currently in process

Update comment by auto on 02 Dec 2007 04:43

Domain "2z26B00" hits Domain "2z25A00" (99.4236311239193% over 100%) which is currently in process

Update comment by auto on 02 Dec 2007 04:11

Domain "2z26B00" hits Domain "2z24B00" (99.4236311239193% over 100%) which is currently in process

Update comment by auto on 02 Dec 2007 03:47

Domain "2z26B00" hits Domain "2z28B00" (99.135446685879% over 100%) which is currently in process

Update comment by auto on 02 Dec 2007 03:23

Domain "2z26B00" hits Domain "2z28A00" (99.135446685879% over 100%) which is currently in process

Update comment by auto on 02 Dec 2007 02:57

Domain "2z26B00" hits Domain "2z24A00" (99.4236311239193% over 100%) which is currently in process

Update comment by auto on 02 Dec 2007 02:31

Domain "2z26B00" hits Domain "2z27A00" (99.135446685879% over 100%) which is currently in process

Flow stage update by auto on 02 Dec 2007 02:10

Domain "2z26B00" hits Domain "2z27A00" (99.135446685879% over 100%) which is currently in process

Flow stage update by auto on 02 Dec 2007 02:10

NW result present for Domain "2z26B00"

Flow stage update by auto on 24 Nov 2007 14:38

All required files are present for Domain "2z26B00"

Flow stage update by auto on 24 Nov 2007 02:37

Beginning processing for Domain "2z26B00"

Insertion by auto on 23 Nov 2007 20:41

Final ChopClose added based on similarity with "2z26A"