CATH Domain: 2z16B01 XML data for domain: 2z16B01

Molscript image for 2z16B01
2z16B01
PDB coordinates for domain 2z16B01

PDB 2z16, Chain B, Domain 1

CATH CodeLevel DescriptionLinks
1 Mainly Alpha
1.20 Up-down Bundle
1.20.91 Influenza Virus Matrix Protein; Chain A, domain 1
1.20.91.10 Gene3D
1.20.91.10.1
1.20.91.10.1.1
1.20.91.10.1.1.1
1.20.91.10.1.1.1.1
1.20.91.10.1.1.1.1.1

[top]
Segment boundaries for domain 2z16B01

Chopping figure for domain 2z16B01
DomainStart PDB ResidueStop PDB Residue
2z16B01 -1 79
2z16B02 80 157

Structural Neighbourhood (1 entries)

There are 1 matching structural neighberhood comparisons for CATH ID 1.20.91.10.1.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 1 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2qzgC01 77.05 Hypothetical proteinMethanococcus maripaludisConserved hypothetical archaeal protein 1.20.1440.50 81 2 86 3.98 4.61
[1]
Displaying entries 1 to 1 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2z16B01
SGMSLLTEVETYVLSIIPSGPLKAEIAQKLEDVFAGKNTDLEALMEWLKTRPILSPLTKGILGFVFTLTVPSEQRRRF
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2z16B01
GSSGSSGMSLLTEVETYVLSIIPSGPLKAEIAQKLEDVFAGKNTDLEALMEWLKTRPILSPLTKGILGFVFTLTVPSERG
LQRRRF
BLAST against CATH

[top]
Domain History Events (8)

Domain assigned by auto on 17 May 2008 20:25

Assigning to "1.20.91.10" based on similarity with "2z16A01"

Flow stage update by auto on 17 May 2008 20:24

No in_process hits for Domain "2z16B01" ready to be processed

Update comment by auto on 17 May 2008 17:23

Domain "2z16B01" hits Domain "2z16A01" (100% over 100%) which is currently in process

Flow stage update by auto on 17 May 2008 17:08

Domain "2z16B01" hits Domain "2z16A01" (100% over 100%) which is currently in process

Flow stage update by auto on 17 May 2008 17:08

NW result present for Domain "2z16B01"

Flow stage update by auto on 17 May 2008 08:19

All required files are present for Domain "2z16B01"

Flow stage update by auto on 16 May 2008 11:46

Beginning processing for Domain "2z16B01"

Insertion by auto on 16 May 2008 11:07

Final ChopClose added based on similarity with "2z16A"