CATH Domain: 2z01A01 XML data for domain: 2z01A01

Molscript image for 2z01A01
2z01A01
PDB coordinates for domain 2z01A01

PDB 2z01, Chain A, Domain 1

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.1330 60s Ribosomal Protein L30; Chain: A;
3.30.1330.10 Gene3D
3.30.1330.10.2
3.30.1330.10.2.1
3.30.1330.10.2.1.1
3.30.1330.10.2.1.1.1
3.30.1330.10.2.1.1.1.1

[top]
Segment boundaries for domain 2z01A01

Chopping figure for domain 2z01A01
DomainStart PDB ResidueStop PDB Residue
2z01A01 17 167
2z01A02 168 342

Structural Neighbourhood (0 entries)

Sorry, we could not find any non-redundant representatives with similar structural scores to this domain in CATH.


[top]
Domain ATOM Sequence 

>pdb|2z01A01
QAVALMKEHVQKTMRPEVLGGGLFDLSALGYRQPVLISGTDGVGTKLKLAFLLDRHDTIGIDCVAMCVNDIIVQGAEPLF
FLDYIACGKAVPEKIAAIVKGVADGCVEAGCALIGGETAEEYDLAGFAVGVAEKERLI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2z01A01
QAVALMKEHVQKTMRPEVLGGIGGFGGLFDLSALGYRQPVLISGTDGVGTKLKLAFLLDRHDTIGIDCVAMCVNDIIVQG
AEPLFFLDYIACGKAVPEKIAAIVKGVADGCVEAGCALIGGETAEMPGMYDEDEYDLAGFAVGVAEKERLI
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 01 Dec 2007 22:15

Assigning to "3.30.1330.10" based on similarity with "2btuA01"

Flow stage update by auto on 01 Dec 2007 22:04

No in_process hits for Domain "2z01A01" ready to be processed

Flow stage update by auto on 01 Dec 2007 22:04

NW result present for Domain "2z01A01"

Flow stage update by auto on 24 Nov 2007 14:38

All required files are present for Domain "2z01A01"

Flow stage update by auto on 23 Nov 2007 14:01

Beginning processing for Domain "2z01A01"

Insertion by auto on 23 Nov 2007 10:58

Final ChopClose added based on similarity with "2btuA"