CATH Domain: 2yyyA02 XML data for domain: 2yyyA02

Molscript image for 2yyyA02
2yyyA02
PDB coordinates for domain 2yyyA02

PDB 2yyy, Chain A, Domain 2

CATH CodeLevel DescriptionLinks
3 Alpha Beta
3.30 2-Layer Sandwich
3.30.360 Dihydrodipicolinate Reductase; domain 2
3.30.360.10 Dihydrodipicolinate Reductase; domain 2 Gene3D
3.30.360.10.6
3.30.360.10.6.1
3.30.360.10.6.1.1
3.30.360.10.6.1.1.1
3.30.360.10.6.1.1.1.1

[top]
Segment boundaries for domain 2yyyA02

Chopping figure for domain 2yyyA02
DomainStart PDB ResidueStop PDB Residue
2yyyA01 2 142
2yyyA01 311 343
2yyyA02 143 310

Structural Neighbourhood (2 entries)

There are 2 matching structural neighberhood comparisons for CATH ID 3.30.360.10.6.1.1.1.1 (SIMAX score < 5)

[1]
Displaying entries 1 to 2 (page 1 of 1)
Match Depth Match SSAP score Match Keywords Match Superfamily Length Sequence Id Overlap RMSD SIMAX
2hjsA02 81.80 Pseudomonas aeruginosaCysteine and methionine metabolismAspartate-semialdehyde dehydrogenase [EC:1.2.1.11]Glycine, serine and threonine metabolismUSG-1 protein homolog 3.30.360.10 184 10 81 2.97 3.64
1t4bA02 76.99 Glycine, serine and threonine metabolismLysine biosynthesisMetabolic pathwaysCysteine and methionine metabolismAspartate-semialdehyde dehydrogenase activity 3.30.360.10 216 10 69 3.09 4.42
[1]
Displaying entries 1 to 2 (page 1 of 1)


[top]
Domain ATOM Sequence 

>pdb|2yyyA02
SCNTTGLCRILYAINSIADIKKARIVLVRRAADPNDDKTGPVNAITPNPVTVPSHHGPDVVSVVPEFEGKILTSAVIVPT
TLMHMHTLMVEVDGDVSRDDILEAIKKTPRIITVRAEDGFSSTAKIIEYGRDLGRLRYDINELVVWEESINVLENEIFLM
QAVHQESI
BLAST against CATH

[top]
Domain COMBS Sequence 

>pdb|2yyyA02
SCNTTGLCRILYAINSIADIKKARIVLVRRAADPNDDKTGPVNAITPNPVTVPSHHGPDVVSVVPEFEGKILTSAVIVPT
TLMHMHTLMVEVDGDVSRDDILEAIKKTPRIITVRAEDGFSSTAKIIEYGRDLGRLRYDINELVVWEESINVLENEIFLM
QAVHQESI
BLAST against CATH

[top]
Domain History Events (6)

Domain assigned by auto on 01 Dec 2007 22:14

Assigning to "3.30.360.10" based on similarity with "1cf2O02"

Flow stage update by auto on 01 Dec 2007 22:04

No in_process hits for Domain "2yyyA02" ready to be processed

Flow stage update by auto on 01 Dec 2007 22:04

NW result present for Domain "2yyyA02"

Flow stage update by auto on 24 Nov 2007 14:38

All required files are present for Domain "2yyyA02"

Flow stage update by auto on 24 Nov 2007 02:37

Beginning processing for Domain "2yyyA02"

Insertion by auto on 23 Nov 2007 18:16

Final ChopClose added based on similarity with "2yyyB"